DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and SGE1

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_015524.1 Gene:SGE1 / 856327 SGDID:S000006402 Length:543 Species:Saccharomyces cerevisiae


Alignment Length:425 Identity:92/425 - (21%)
Similarity:155/425 - (36%) Gaps:104/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPAGTAWL-TGYLFLSAALGALVSGFLALKIGPKSVLLCSGLLQISGWACIHFGYDIVHIYASRL 117
            |.....|| |||. ||.|:..|:.|.||..:|.|..|:.|.::...|.........:..:.:.|:
Yeast    41 DFGNIGWLVTGYA-LSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRV 104

  Fly   118 FAGVASGA----AFVVLPIFINEIAESREKAARLTFTIELWRTLGILIGFVLGFYVPYA---FVN 175
            .||.....    ||||....:.|........| |..:..:...:|..||.....::.:.   ::|
Yeast   105 VAGFGGSGIESLAFVVGTSIVRENHRGIMITA-LAISYVIAEGVGPFIGGAFNEHLSWRWCFYIN 168

  Fly   176 IVGCAVSFVFTMTFPFVQESPHYYLRKNNMASLEKSLRWYRGIRDIDDREKPEYLSELNEFHAEL 240
            :...|.:|:. :.|......||   :|..:.|..|.:..|    |..:..|..:..  |.|...:
Yeast   169 LPIGAFAFII-LAFCNTSGEPH---QKMWLPSKIKKIMNY----DYGELLKASFWK--NTFEVLV 223

  Fly   241 RSRDKNVGSTPMSHGYIIRLTFVSF----------------------LLTVCAKLSGVFVELNYA 283
            ...|. ||....|.|:.:.:..:||                      ||..||          |.
Yeast   224 FKLDM-VGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICFFTVGPILLLLFCA----------YD 277

  Fly   284 ADFLGRTG--YSTETNYVVLA---SAQCAGALLARLVGPRLPRKLLLCLSSLFAAAAVIAL--AL 341
            ..||..:|  |..:....:|.   ::.| |...:.:.|      .|.|.:....:|.::.|  .:
Yeast   278 FHFLSLSGLHYDNKRIKPLLTWNIASNC-GIFTSSITG------FLSCFAYELQSAYLVQLYQLV 335

  Fly   342 FK-----AYGHLW------LLGNWADRYL--------PIILLAIQLALVSFGLYPLAAVVSSEVL 387
            ||     |..|||      ::...|..||        |.|:..:...:|..||:.|   ::.|  
Yeast   336 FKKKPTLASIHLWELSIPAMIATMAIAYLNSKYGIIKPAIVFGVLCGIVGSGLFTL---INGE-- 395

  Fly   388 PTKLHDLLYSLASAVSWLLLFGMIEAFNAV-KATI 421
                      |:.::.:.:|.|:  ||.:: :||:
Yeast   396 ----------LSQSIGYSILPGI--AFGSIFQATL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 35/145 (24%)
Sugar_tr 58..453 CDD:278511 91/421 (22%)
SGE1NP_015524.1 MFS_Azr1_MDR_like 24..531 CDD:341045 92/425 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.