DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and VBA2

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_009852.3 Gene:VBA2 / 852596 SGDID:S000000497 Length:474 Species:Saccharomyces cerevisiae


Alignment Length:395 Identity:77/395 - (19%)
Similarity:137/395 - (34%) Gaps:118/395 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGPAIQSVATALGNILCFNFGLMFGITPAHMTLYESEERTPLNQAT--------------DPAGT 58
            ||    ::|:::|...||...:...:..:.:..|....:...|:..              |..|:
Yeast   111 GG----TIASSIGWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGS 171

  Fly    59 AW-LTG----YLFLSAALGALVS-------GFLALKIGPKSVLLC-------SGLLQISGWACIH 104
            .. :||    .|:||  ||...|       ..|.|.:|...:||.       :....|.....::
Yeast   172 ILIITGLTLQLLYLS--LGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVN 234

  Fly   105 FGYDIVHIYASRLFAGVASGAAFVVLPIFINEIAESREKAARLTFTI-ELWRTLGILI-GFVLGF 167
            ..|.:| :.:..:..|.||.|....||:|...:.......|.|..|| .|:..:|.|| ||.:..
Yeast   235 SSYSVV-VLSISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFSMSK 298

  Fly   168 YVPYAFVNIVGCAVSFVFTMTFPFVQE-SPHYYL--------------------------RKNNM 205
            |.....:..:|.::.|:....|.|::: ||::.:                          .|::.
Yeast   299 YNCLRLLLYIGISLMFLGNFLFLFIEKTSPNWLIGLFLIPANLGQGITFPTTLFTFIFMFSKSDQ 363

  Fly   206 ASLEKSLRWYRGIRDIDDREKPEYLSELNEFHAELRSRDKNVGSTPMSHGYIIRLTFVSFL---- 266
            |:...:|..:|.|                          .:|....:|.| :|:|:|...|    
Yeast   364 ATATSTLYLFRSI--------------------------GSVWGVAISAG-VIQLSFAGLLRSNL 401

  Fly   267 --LTVCAKLSGVFVELNYAADFLGRTGYSTETNYVVLAS-------AQCAGALLARLVGPRLPRK 322
              |....|:..:.|:|:..:.::|  ....|....|:.|       |.....||:.|.       
Yeast   402 KGLLDENKIKKLIVQLSANSSYIG--SLHGEVKNTVIKSFDEATKRAHLMSTLLSSLA------- 457

  Fly   323 LLLCL 327
            |:||:
Yeast   458 LILCI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 39/158 (25%)
Sugar_tr 58..453 CDD:278511 67/331 (20%)
VBA2NP_009852.3 MFS 1..384 CDD:421695 56/305 (18%)
TRI12 <107..>249 CDD:115279 26/144 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.