DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and SLC2A3

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_008862.1 Gene:SLC2A3 / 6515 HGNCID:11007 Length:496 Species:Homo sapiens


Alignment Length:495 Identity:102/495 - (20%)
Similarity:186/495 - (37%) Gaps:108/495 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ATALGNILCFNFGLMFGITPA-HMTLYESEERTPLNQATDPAGTAWLTGYLFLSAA-------LG 72
            |..:..|..|.||...|:..| ...:.|...:|..::...|.....||....||.|       :|
Human    13 AITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIG 77

  Fly    73 ALVSGFLALKIGPKSVLLCSGLLQISGWACI----HFGYDIVHIYASRLFAGVASGAAFVVLPIF 133
            :...|....:.|.::.:|...||.::| .|.    .....:..:...||..|:..|.....:|::
Human    78 SFSVGLFVNRFGRRNSMLIVNLLAVTG-GCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMY 141

  Fly   134 INEIAESREKAARLTFTIELWRTLGILIG------FVLGFYVPYAFVNIVGCAV--SFVFTMTFP 190
            |.||:.:..:.|..|.. :|...:|||:.      |:||....:..  ::|..:  :.:.:...|
Human   142 IGEISPTALRGAFGTLN-QLGIVVGILVAQIFGLEFILGSEELWPL--LLGFTILPAILQSAALP 203

  Fly   191 FVQESPHYYL-RKNNMASLEKSLRWYRGIRDIDDREKPEYLSELNEFHAELRSRDKNVGSTPMSH 254
            |..|||.:.| .:....:.::.|:...|.:|:.     :.:.|:.:..|.: |::|.|  |.:. 
Human   204 FCPESPRFLLINRKEEENAKQILQRLWGTQDVS-----QDIQEMKDESARM-SQEKQV--TVLE- 259

  Fly   255 GYIIRLT------FVSFLLTVCAKLSGVFVELNYAADFLGRTGYSTETNYVVLASAQCAGALLAR 313
              :.|::      .:|.:|.:..:|||:.....|:.......|.. |..|..:.    ||.    
Human   260 --LFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQ-EPIYATIG----AGV---- 313

  Fly   314 LVGPRLPRKLLLCLSSLFAAAAVIALALFKAYG----HLWLLGNWA-------------DRY--L 359
                         ::::|   .|::|.|.:..|    |:..||..|             |.|  :
Human   314 -------------VNTIF---TVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGM 362

  Fly   360 PIILLAIQLALVSF---GLYPLAAVVSSEVLPTKLHDLLYSLASAVSWLLLFGMIEAFNAVKATI 421
            ..:.:...|..|:|   |..|:...:.:|:..........::|...:|        ..|.:...:
Human   363 SFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNW--------TSNFLVGLL 419

  Fly   422 APGLLLYL--WVFAGASIFVGLISLPL------LPETRNR 453
            .|....||  :||.   ||.|.:...|      :||||.|
Human   420 FPSAAHYLGAYVFI---IFTGFLITFLAFTFFKVPETRGR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 33/156 (21%)
Sugar_tr 58..453 CDD:278511 91/450 (20%)
SLC2A3NP_008862.1 MFS_GLUT_Class1 12..456 CDD:340989 101/493 (20%)
Important for selectivity against fructose. /evidence=ECO:0000269|PubMed:26176916 277..279 0/1 (0%)
Monosaccharide binding. /evidence=ECO:0000269|PubMed:26176916 280..286 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.