DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and SLC2A2

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_000331.1 Gene:SLC2A2 / 6514 HGNCID:11006 Length:524 Species:Homo sapiens


Alignment Length:520 Identity:113/520 - (21%)
Similarity:197/520 - (37%) Gaps:106/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RVGGPAIQSVATA-LGNILCFNFGLMFGITPA----------HMTLYESEERTPLN----QATD- 54
            :|.|..:.:|.|| ||:   |.||...|:..|          |:.....::|..:|    .:|| 
Human     5 KVTGTLVFTVITAVLGS---FQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDE 66

  Fly    55 ---------PAGTAW--------------LTGYLFLSAALGALVS----GFLALKIGPKSVLLCS 92
                     |..|.|              |......|.|:|.:.:    |:|...:|....:|.:
Human    67 LPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGDTLGRIKAMLVA 131

  Fly    93 GLLQISGWACIHF---GYDIVHIYASRLFAGVASGAAFVVLPIFINEIAESREKAARLTFTIELW 154
            .:|.:.|...:.|   |...:.|.|.|..:|:..|....::|::|.|||.:..:.|..||. :|.
Human   132 NILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIAPTALRGALGTFH-QLA 195

  Fly   155 RTLGILIG------FVLGFY-VPYAFVNIVGCAVSFVFTMTFPFVQESPHY-YLRKNNMASLEKS 211
            ...||||.      |:||.| :.:..:.:.|........:.| |..|||.| |::.:.....::|
Human   196 IVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLF-FCPESPRYLYIKLDEEVKAKQS 259

  Fly   212 LRWYRGIRDIDDREKPEYLSELNEFHAELRSRDKNVGSTPMSHGYIIRL---------TFVSFLL 267
            |:..||..|:        ..::||...|   |::......:|   ||:|         ..|:.:|
Human   260 LKRLRGYDDV--------TKDINEMRKE---REEASSEQKVS---IIQLFTNSSYRQPILVALML 310

  Fly   268 TVCAKLSGVFVELNYAADFLGRTG-----YST----ETNYVVLASAQCAGALLARLVGPRLPRKL 323
            .|..:.||:.....|:.......|     |:|    ..|.|..|    ....|....|.|  ...
Human   311 HVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTA----VSVFLVEKAGRR--SLF 369

  Fly   324 LLCLSSLFAAAAVIALALFKAYGHLWLLGNWADRYLPIILLAIQLALVSFGLYPLAAVVSSEVLP 388
            |:.:|.:|..|..:::.|.......|:      .|:.:|.:.:.::....|..|:...:.:|...
Human   370 LIGMSGMFVCAIFMSVGLVLLNKFSWM------SYVSMIAIFLFVSFFEIGPGPIPWFMVAEFFS 428

  Fly   389 TKLHDLLYSLASAVSWLLLFGMIEAFNAVKATIAPGLLLYLWVFAGASIFVGLISLPLLPETRNR 453
            ........::|:..:|...|.:...|..:.....|   ...::|||..:...|.:...:|||:.:
Human   429 QGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGP---YVFFLFAGVLLAFTLFTFFKVPETKGK 490

  Fly   454  453
            Human   491  490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 40/175 (23%)
Sugar_tr 58..453 CDD:278511 95/441 (22%)
SLC2A2NP_000331.1 Sugar_tr 14..499 CDD:278511 111/511 (22%)
MFS 98..485 CDD:119392 89/417 (21%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 314..320 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.