DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and SLC2A1

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_006507.2 Gene:SLC2A1 / 6513 HGNCID:11005 Length:492 Species:Homo sapiens


Alignment Length:491 Identity:104/491 - (21%)
Similarity:187/491 - (38%) Gaps:80/491 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRVGGPAIQSVATA-LGNILCFNFGLMFGITPA-HMTLYESEERTPLNQATDPAGTAWLTGYLFL 67
            |::.|..:.:|..| ||::   .||...|:..| ...:.|...:|.:::..:......||....|
Human     6 KKLTGRLMLAVGGAVLGSL---QFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSL 67

  Fly    68 SAA-------LGALVSGFLALKIGPKSVLLCSGLLQISGWACIHF---GYDIVHIYASRLFAGVA 122
            |.|       :|:...|....:.|.::.:|...||.......:.|   |.....:...|...||.
Human    68 SVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVY 132

  Fly   123 SGAAFVVLPIFINEIAESREKAARLTFTIELWRTLGIL--IGFVLGFYVPYAF--VNIVG----- 178
            .|.....:|:::.|::.:..:.|           ||.|  :|.|:|..:...|  .:|:|     
Human   133 CGLTTGFVPMYVGEVSPTALRGA-----------LGTLHQLGIVVGILIAQVFGLDSIMGNKDLW 186

  Fly   179 -CAVSFVF------TMTFPFVQESPHYYLRKNNMASLEKS-LRWYRGIRDIDDREKPEYLSELNE 235
             ..:|.:|      .:..||..|||.:.|...|..:..|| |:..||..|:        ..:|.|
Human   187 PLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADV--------THDLQE 243

  Fly   236 FHAELRS--RDKNVGSTPMSHGYIIRL-TFVSFLLTVCAKLSGVFVELNYAADFLGRTGYSTETN 297
            ...|.|.  |:|.|....:......|. ..::.:|.:..:|||:.....|:.....:.|.. :..
Human   244 MKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQ-QPV 307

  Fly   298 YVVLAS--AQCAGALLARLVGPRLPRKL--LLCLSSLFAAAAVIALALFKAYGHLWLLGNWADRY 358
            |..:.|  ...|..:::..|..|..|:.  |:.|:.:...|.::.:||.......|:      .|
Human   308 YATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWM------SY 366

  Fly   359 LPIILLAIQLALVSFGLYPLAAVVSSEVLPTKLHDLLYSLASAVSWLLLFGMIEAFNAVKATIAP 423
            |.|:.:...:|....|..|:...:.:|:..........::|...:|...|.:...|..|:....|
Human   367 LSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGP 431

  Fly   424 GLLLYLWVFAGASIFVGLISLPLL------PETRNR 453
                |:::     ||..|:.|..:      |||:.|
Human   432 ----YVFI-----IFTVLLVLFFIFTYFKVPETKGR 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 32/163 (20%)
Sugar_tr 58..453 CDD:278511 91/434 (21%)
SLC2A1NP_006507.2 MFS_GLUT_Class1 14..458 CDD:340989 101/481 (21%)
Monosaccharide binding. /evidence=ECO:0000269|PubMed:24847886 282..288 3/5 (60%)
Disordered. /evidence=ECO:0000305|PubMed:30197081 468..492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.