DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and SLC2A9

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_011512158.1 Gene:SLC2A9 / 56606 HGNCID:13446 Length:615 Species:Homo sapiens


Alignment Length:462 Identity:122/462 - (26%)
Similarity:196/462 - (42%) Gaps:75/462 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IQSVATALGN--ILCFNFGLMFGITPAHMTLY-ESEER---TPLNQATDPAGTAW-LTGYLFLSA 69
            :.|:|.|.|:  :..:|..::...||.....| ||.||   .|::  .|.....| :|..:|   
Human    58 VASLAGAFGSSFLYGYNLSVVNAPTPYIKAFYNESWERRHGRPID--PDTLTLLWSVTVSIF--- 117

  Fly    70 ALGALVSGFLALK-----IGPKSVLLCSGLLQISG---WACIHFGYDIVHIYASRLFAGVASGAA 126
            |:|.|| |.|.:|     :|.|..||.:....||.   .||.........:...|...|:..|.|
Human   118 AIGGLV-GTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQAGAFEMLIVGRFIMGIDGGVA 181

  Fly   127 FVVLPIFINEIA--ESREKAARLTFTIELWRTLGILIGFVLGF--------YVPYAFVNIVGCAV 181
            ..|||::::||:  |.|....::|   .::..:|:..|.:||.        ..||.|..||..||
Human   182 LSVLPMYLSEISPKEIRGSLGQVT---AIFICIGVFTGQLLGLPELLGKESTWPYLFGVIVVPAV 243

  Fly   182 SFVFTMTFPFVQESPHY-YLRKNNMASLEKSLRWYRGIRDIDDREKPEYLSELNEFHAELRSRDK 245
              |..::.||:.:||.| .|.|:|.|...|:.:.:.|..|: .:|..|.|:|     :.::...:
Human   244 --VQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKADV-SQEVEEVLAE-----SRVQRSIR 300

  Fly   246 NVGSTPMSHGYIIRLTFVSFLLTV-CAKLSGVFVELNYAADFLGRTGY-STETNYVVLASA--QC 306
            .|....:.....:|...|:.::|: |.:|.|:.....|.....|:.|. ..:..||.|::.  :.
Human   301 LVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIET 365

  Fly   307 AGALLARLVGPRLPRKLLLC----LSSLFAAAAVIALALFKAYGHL-WLLGNWADRYLPII-LLA 365
            ..|:.:.||...|.|:.||.    |..||.....|.|.|   ..|. |:      .||.|: :||
Human   366 LAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTITLTL---QDHAPWV------PYLSIVGILA 421

  Fly   366 IQLALVSFGLYP--LAAVVSSEVLPTKLHDLLYSLASAVSWL------LLFGMIEAFNAVKA--T 420
            |   :.||...|  :..:::.|..........:.:|..|:||      |||..|:....:.:  .
Human   422 I---IASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQLLLLLLSLLR 483

  Fly   421 IAPGLLL 427
            |.||..|
Human   484 IQPGFKL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 44/156 (28%)
Sugar_tr 58..453 CDD:278511 108/410 (26%)
SLC2A9XP_011512158.1 2A0115 48..462 CDD:273327 114/432 (26%)
MFS 61..466 CDD:119392 113/433 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.