DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and AgaP_AGAP008720

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_001237606.1 Gene:AgaP_AGAP008720 / 4578076 VectorBaseID:AGAP008720 Length:215 Species:Anopheles gambiae


Alignment Length:184 Identity:44/184 - (23%)
Similarity:75/184 - (40%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IQSVATALGNILCFNFGLMFGITPAHMTLYESEERTPLNQATDPAGTAWLTGYLFLSAALGALVS 76
            :|.|...:.||...:.|:  ||....:.:.|....|.....|:...| |......:....|.|:|
Mosquito    40 VQIVTAVVANITIISSGM--GIGFPSIAMIELTNSTTSVVLTESDAT-WFASITSIMCPFGGLLS 101

  Fly    77 GFLALKIGPKSVLLCSGLLQISGWACIHFGYD------IVHIYASRLFAGVASGAAFVVLPIFIN 135
            |:|..|:|.|..|....::.|..||.:.|...      .:.:..:|:..|:|.|.:.....::..
Mosquito   102 GYLLDKVGRKKTLYFINIISIVSWAIMSFASRTDSATLFIQLIVARIIIGIAIGLSSTPASVYAA 166

  Fly   136 EIAESREKAARLTFTIELWRTLGILIGFVLG--FYVPYAFVNIVGCAVSFVFTM 187
            |:|....: .|||........:|:|..:.||  |...:.||    |.:..:||:
Mosquito   167 EVAHPNLR-GRLTLLTAFCTAIGMLSIYTLGYVFKNDWRFV----CMICGIFTV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 34/142 (24%)
Sugar_tr 58..453 CDD:278511 34/138 (25%)
AgaP_AGAP008720XP_001237606.1 MFS 46..>215 CDD:119392 41/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.