DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and CG17930

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_650533.1 Gene:CG17930 / 41979 FlyBaseID:FBgn0038416 Length:502 Species:Drosophila melanogaster


Alignment Length:426 Identity:90/426 - (21%)
Similarity:166/426 - (38%) Gaps:76/426 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AWLTGYLFLSAALGALVSGFLALKIGPKSVLL-CSGLLQ-ISGWACIHFGYDIVHIYASRLFAGV 121
            :|..| :.:.|.:.|:.|.||     ||.|.. ..|::. |.....:...|:...|.|:|...||
  Fly   100 SWFIG-VIIGAVVSAITSAFL-----PKIVFYGLGGVMNLIDAIIFVSAPYEYESILAARYVGGV 158

  Fly   122 ASGAAFVVLPIFIN--EIAESREK---------------AARLTFTIELWRTLGILIGFVLG-FY 168
              |...:.:|..|:  |||.|..:               |.::.:..:..:.||:.|..|.| |.
  Fly   159 --GIGLITVPFLIHSAEIASSTNRGTCCALEQYGLALGVAIQVIYDSQWSQGLGMTINRVHGIFG 221

  Fly   169 VPYAFVNIVGCAVSFVFTMTFPFVQESPHYYLRKNNMASLEKSLRWYRG---IRDIDDREKPEYL 230
            :.:..:.:...|::.          :||.:|:|:|.......|::...|   .|:..||...|  
  Fly   222 IVFTAIALGSVAITI----------DSPIFYIRQNQEQKARASVKQLMGSYWTREAGDRAYDE-- 274

  Fly   231 SELNEFHAELRSRDKNVGSTPMSHGYIIRLTFVSFLLTVCAKLSGVFVELNYA----ADFLGRTG 291
            ::|.......:...:.:|.:.|        .|:..||..|.......|.|:|:    .:.:..|.
  Fly   275 AKLYVVEGSAQGVGEQLGESMM--------PFLKLLLFRCFVAFTFSVPLSYSILTTTELVEGTL 331

  Fly   292 YSTETNYVVLASAQCAGALLARLVGPRLPRKLLLCLSSLFAAAAVIALA-LFKAYGHLWLLGNWA 355
            :|..|  ::....:..|||:...|...:.||.:..|..:..|..::.:| ::..|||::      
  Fly   332 HSWPT--IIFGLLRLIGALITFAVLDTVGRKFVSLLGLMCMAGLMLGMAGVYGDYGHIF------ 388

  Fly   356 DRYLPIILLAIQLALVSFGLYPL--AAVVSSEVLPTKLHDLLYSLASAVSWLLLFGMIEAFNAVK 418
            |.|....:..:.:|...|..:.:  ::....|..|.::...|..|...:..::...:|..|    
  Fly   389 DDYFMWQVCRLGMAFQFFAGFFICSSSAYLGEAFPMRVKPFLIGLIVCLEQVIHIIVIVKF---- 449

  Fly   419 ATIAPGLLLYLWVFAGASIF--VGLISLP-LLPETR 451
               .|....|...|....|.  :||::.. |:||||
  Fly   450 ---VPTAEFYYTYFVAVGIIMVIGLVAFAVLMPETR 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 33/152 (22%)
Sugar_tr 58..453 CDD:278511 90/426 (21%)
CG17930NP_650533.1 Sugar_tr 102..493 CDD:278511 89/424 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444396
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.