DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and CG17929

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_650532.2 Gene:CG17929 / 41978 FlyBaseID:FBgn0038415 Length:491 Species:Drosophila melanogaster


Alignment Length:488 Identity:111/488 - (22%)
Similarity:187/488 - (38%) Gaps:126/488 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NILCFNFGLMF--GITPAHMTLYESEERTPLNQATDPAGTAWLTGYLFLSAALGALVSGFLALKI 83
            |:.|..|.|..  |:..||...:.....|   .||.....:|..|.| ..|||.:|...||    
  Fly    53 NVACAVFFLYVYGGMDFAHSAGWNQTLNT---TATQVFKCSWFIGVL-AGAALASLTMTFL---- 109

  Fly    84 GPK-SVLLCSGLLQISG---WACIHFGYDIVHIYASRLFAGVASGAAFVVLPIFINEIAESREKA 144
             || ...:..||:|::|   :.|..|.|..  :.|:|..||  :|...:.:|..|:....:.:..
  Fly   110 -PKLPFYVLGGLMQLTGSIIFTCKPFDYGC--LLAARYVAG--AGIGLITVPFLIHSAEVATDNH 169

  Fly   145 ARLTFTIELWRTLGILIGFVLGFYVPY---------AFVNIVGCAVSFVFT-----MTFPFVQES 195
            ..::.::|   ..|:.:|  :...|.|         |.||.|...:..||:     ||...: ||
  Fly   170 RGVSGSME---QCGLALG--IAIQVIYDTQWVDDKEASVNEVHGIIGIVFSIIGLGMTALSI-ES 228

  Fly   196 PHYYLRKNNMASLEKSLRWYRGIRDIDDREKPEYLSELNEFHAELRSR----DKNVGSTP----- 251
            |.||||   :...||:.:.:..:....:....:...|:..:.||.:.|    :..:...|     
  Fly   229 PIYYLR---IKQKEKARKCHAKLLGSFNHSVDQEFEEIQLYVAESQKRTFCQELRISVVPFIKLL 290

  Fly   252 MSHGYIIRLTFVSFLLTVCAKL--SGVFVELNYAADFLGRTGYSTETNYVVLASAQCAGALLARL 314
            :..|::.    .||.|.:...|  |.:..|           |:.:.....|....:..|||:|:.
  Fly   291 LYRGFVA----FSFSLPLSESLIKSALLTE-----------GFISCWPVTVWGLVRLLGALVAQG 340

  Fly   315 VGPRLPRK------------LLLCLSSLFAAAAVIALALFKAYGHLWLLGNWADRYLPIILLAIQ 367
            ...:|.||            |:||:::.:|..| .||..:..| .:|.||               
  Fly   341 FLDKLGRKFVSLVGLLCMAILMLCMAASYANPA-NALMTYYMY-QVWRLG--------------- 388

  Fly   368 LALVSF-GLYPL-AAVVSSEVLPTKLHDLLYSLASAVSWLLLFGM-IEAFNAVKAT--------- 420
            ||..:| ||:.. ::|...|..|.|:....      |.:::.|.. |...|.|...         
  Fly   389 LAFQAFAGLFVCSSSVYLGEAFPIKVKPFF------VGYIIGFEQTIHIINIVGYNKGYENFFYH 447

  Fly   421 --IAPGLLLYLWVFAGASIFVGLISLPLLPETR 451
              ::.|::|.:.|     :|.|::    :|||:
  Fly   448 YYLSVGIILLVGV-----VFFGIV----IPETK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 38/155 (25%)
Sugar_tr 58..453 CDD:278511 101/449 (22%)
CG17929NP_650532.2 Sugar_tr 67..482 CDD:278511 106/474 (22%)
MFS 295..>425 CDD:119392 36/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.