DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and CG14605

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_649707.3 Gene:CG14605 / 40867 FlyBaseID:FBgn0037486 Length:432 Species:Drosophila melanogaster


Alignment Length:459 Identity:112/459 - (24%)
Similarity:194/459 - (42%) Gaps:69/459 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GLMFG-ITPAHMTLYESEERTPLNQATDPAGTAWL-----TGYLFLSAALGALVSGFLALKIGPK 86
            |:..| .:|...||.  .:.:|:....|.:...|:     .|.|..:..:...||.|     |.|
  Fly     6 GISLGWFSPTLPTLI--SDNSPIGHPIDISEVKWIGASFGIGCLICNMVICVPVSYF-----GIK 63

  Fly    87 SVLLCSGLLQISGWACIHFGYDIVHIYASRLFAGVASGAAFVVLPIFINEIAESREKAARLTFTI 151
            ..:....|..|..|..|:|....::.|..|:..|::.|...|..|:||.|::::   :.|.|...
  Fly    64 KCMYFVPLPNILNWVLIYFASKSLYFYVCRVLLGISGGTLVVCFPVFIAEVSDN---SVRGTLGS 125

  Fly   152 ELWRTL--GILIGFVLGFYVPYAFVNIVGCAVSFV----FTMTFPFVQESPHYYLRKNNMASLEK 210
            ....||  ||.:||||.:.:.|   :::.|.|.|:    ..:..| :.|.|...|::.:....||
  Fly   126 FFMMTLCSGITVGFVLVYCLSY---HVLPCVVIFLPILYLCLIIP-LPEPPQDLLKRGHEEKAEK 186

  Fly   211 SLRWYRGIRDIDDREKPEYLSELNEFHAELRSRDKNVGSTPMSHGYIIRLTFVSFLLTVCAK--- 272
            |..:|:.:.. |..::.:..:|.::.      |:|.:.|     |...::|...|...|..|   
  Fly   187 SFCFYKNLSK-DPAQQDDNKAEFDKL------RNKVLAS-----GIAEKITPADFFNKVSGKAFG 239

  Fly   273 ----------LSGVFVELNYAADFLGRTGYSTETNY--VVLASAQCAGALLARLVGPRLPRKLLL 325
                      :||.|...||::....:.|...|.|.  :.|...|..|.:.|.|:..|:.|:|||
  Fly   240 LIAVLLLSNQMSGSFAIFNYSSTIFEQLGSRMEPNLCGIFLGVVQIFGLISAVLLVDRVGRRLLL 304

  Fly   326 CLSSLFAAAAVIALALFKAYGHLWLLGNWADRYLPIILLAIQLALVSFGLYPLAAVVSSEVLPTK 390
            ..|......|.:.:.|.|::.....|.|  :.::.:.|:.|.....|.|:..|..|:..|:||.|
  Fly   305 IPSLAGMGLAELGVGLLKSFASQDFLHN--NGWIALTLMGIVSFTASAGIVALTFVIIVELLPFK 367

  Fly   391 LHDLLYSLASAVSWLLLFGMIEAFNAVKATIAPGLL----LYLWVFAGASI-FVGLISLPL-LPE 449
            :.      |..:|..:....:..|.|:  ...|.|:    :::.:|..||. .:||:.|.: |||
  Fly   368 IR------APGISISMCGLSLSVFIAL--ITYPVLINDYGVHVTMFVSASFCLLGLVVLGIFLPE 424

  Fly   450 TRNR 453
            ||.:
  Fly   425 TRGK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 38/148 (26%)
Sugar_tr 58..453 CDD:278511 105/426 (25%)
CG14605NP_649707.3 MFS 1..421 CDD:119392 107/450 (24%)
MFS_1 1..387 CDD:284993 98/414 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444361
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004527
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.