DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and Slc2a6

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001100032.1 Gene:Slc2a6 / 296600 RGDID:1309317 Length:321 Species:Rattus norvegicus


Alignment Length:313 Identity:74/313 - (23%)
Similarity:124/313 - (39%) Gaps:45/313 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VPYAFVNIVGCAVSFVFTMTFPFVQESPHYYLRKNNMASLEKSLRWYRGIRDIDDREKPEYLSEL 233
            :|:.::.:.|.....|..:...|:..||.:.|.|:......::|.|.|...::.        .|.
  Rat     8 LPWRWLAVAGEGPVLVMILLLSFMPNSPRFLLSKSRDEEALQALIWLRADSEVH--------WEF 64

  Fly   234 NEFHAELRSRDKNVGSTPMSHGYIIRLTFVSFLLTVCAKLSGVFVELNYAADFLGRTGYSTETNY 298
            .:....:|.:...|.........:.|...::.|:....:|:|:...|.|.......|.       
  Rat    65 EQIQDNVRRQSSRVSWAEAWEPRVYRPILITVLMRFLQQLTGITPILVYLQTIFDSTS------- 122

  Fly   299 VVLASAQCA---GA------LLARLVGPRLPRKLLLCLSSLFAAAAVIALALF----------KA 344
            |||.|.|.|   ||      |:|.:......||:||.:|:.....|.:.|.|:          .:
  Rat   123 VVLPSQQDAAIVGAVRLLSVLIAAVTMDLAGRKVLLYVSASIMFVANLTLGLYVQLVPRTLTPNS 187

  Fly   345 YGHLWLLGNW------ADRYLPII-LLAIQLALVSF--GLYPLAAVVSSEVLPTKLHDLLYSLAS 400
            ...:..||..      |..||.:| |||..|.::.:  |..|:..::.|||||.:...:...|..
  Rat   188 TVEIVTLGGTEQPPAAAFNYLTLIPLLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCV 252

  Fly   401 AVSWLLLFGMIEAFNAVKATIAPGLLLYLWVFAGASIFVGLISLPLLPETRNR 453
            .||||..|.:.:.|  :.|..|.||.:..:.|:...:...|.:...:||||.|
  Rat   253 LVSWLTAFVLTKYF--LLAVNAFGLQVPFFFFSAICLLSLLFTGCCVPETRGR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 3/22 (14%)
Sugar_tr 58..453 CDD:278511 73/311 (23%)
Slc2a6NP_001100032.1 MFS <89..293 CDD:119392 55/212 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.