DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and ght4

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_595064.1 Gene:ght4 / 2539710 PomBaseID:SPBC1683.08 Length:557 Species:Schizosaccharomyces pombe


Alignment Length:457 Identity:104/457 - (22%)
Similarity:168/457 - (36%) Gaps:103/457 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGGPAIQSVATALGNILCFNFGLMFGITPAHMTLYESEERTPLNQATDP-AGTAW----LTGYLF 66
            :||....|::..||                 |..::|......|..|:. :.:||    |||.:.
pombe    19 LGGADTGSISGILG-----------------MRDFQSRFADRYNPITNSYSYSAWRQALLTGTVN 66

  Fly    67 LSAALGALVSGFLALKIGPK-SVLLCSG---------LLQISGWACIHFGYDIVHIYASRLFAGV 121
            .....||::|......||.| |:...||         :..:..|         |.|...:||.|:
pombe    67 AGCLFGAMLSSPFTEAIGKKYSIAFFSGCYIIGQILLVTAVPSW---------VQIMVGKLFTGL 122

  Fly   122 ASGAAFVVLPIFINEIAESREKAARLTFTIELWRTLGILIGFVLGFYVPYAFVNI--------VG 178
            ..||..|:.|.:.:|:|..:.:.| :..|.:|::|.|.||.         |.:|:        ..
pombe   123 TIGALSVLSPGYQSEVAPPQIRGA-VVSTYQLFQTCGTLIA---------ACINMGTHKLRKTAS 177

  Fly   179 CAVSF-------VFTMT-FPFVQESPHYYLRKNNMASLEKSLRWYRGIRDIDDREKPEYLSELNE 235
            ...||       :|.|. ..|:.|||.|.:.|...   |::||......::|    ||  ||:.:
pombe   178 WRTSFGINILWGIFLMVGVLFLPESPRYLIYKGRD---EEALRIMCQTAELD----PE--SEIIQ 233

  Fly   236 FHAELRSRDKNV------GSTPMSHGYIIRL-TFVSFLLTVCAKLSGVFVELNYAADFLGRTGYS 293
            .:......|..:      ...|...|..:|. |.:.||..:..:|.|......||......||.:
pombe   234 TNFNTIKSDIEMEMAGGKARWPEVFGKEVRYRTVLGFLTMLLRELIGNNYYFYYATQVFKGTGMT 298

  Fly   294 TETNYVVLASAQCAGALLARL-----VGPRLPRKLLLCLSSLFAAA-AVIALALFKAYGHLWLL- 351
            ......|:..|...|.....|     :|.|.|        .:|.|| ..|...::.|.|...|: 
pombe   299 DIFLPAVILGAINFGTTFGALYTIDNLGRRNP--------LIFGAAFQSICFFIYAAVGDRKLIY 355

  Fly   352 --GNWADRYLPIILLAIQLALVSF--GLYPLAAVVSSEVLPTKLHDLLYSLASAVSWLLLFGMIE 412
              |....|...::::...|.|.|:  ...|:..|:..|..|.:......::|::.:||..| |:.
pombe   356 KNGTSDHRAGAVMIVFSCLFLFSYCCSWGPMGWVIVGETFPIRYRSKCAAVATSGNWLGNF-MVS 419

  Fly   413 AF 414
            .|
pombe   420 FF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 39/168 (23%)
Sugar_tr 58..453 CDD:278511 95/405 (23%)
ght4NP_595064.1 Sugar_tr 9..467 CDD:278511 104/457 (23%)
MFS 10..440 CDD:119392 104/457 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.