DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and K09C4.2

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:96 Identity:20/96 - (20%)
Similarity:34/96 - (35%) Gaps:29/96 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 AIQLALVSFGLYPLAAVVSSEVLPTKLHDLLYSLASAVSWLLLFG-------MIEAFNAVKATIA 422
            ||:|..|            :|:.|.       |..:.|...:|||       ::..|..:.:..:
 Worm    16 AIRLLFV------------TELFPP-------SARTVVGQAMLFGSMAVGMPVVSLFPIINSIFS 61

  Fly   423 PGLLLYLWVFAGASIFVGLISLPLLPETRNR 453
            |   ::...|.......|:.....:||||.|
 Worm    62 P---IFFVPFVIVQTVFGIYLYRYMPETRGR 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392
Sugar_tr 58..453 CDD:278511 19/94 (20%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 19/94 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.