DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and SLC2A7

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_011539126.1 Gene:SLC2A7 / 155184 HGNCID:13445 Length:517 Species:Homo sapiens


Alignment Length:482 Identity:115/482 - (23%)
Similarity:198/482 - (41%) Gaps:91/482 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPKRVG--GPA--IQSVATALGNILCFNFGLMFGITPAHM-------TLYESEERTPLNQATDPA 56
            :|.|.|  .|.  :.:::.|.|:...:.:.|....||..:       |.:|       ..||...
Human    12 IPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETYFE-------RHATFMD 69

  Fly    57 GTAWL-----TGYLF-LSAALGALVSGFLALKIGPKSVLLCSGLLQI-----SGWACIHFGYDIV 110
            |...|     |..:| |...||:|:.|.|....|.|..||.:.:..|     .|.:.:...::: 
Human    70 GKLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAILMGVSKVAKAFEL- 133

  Fly   111 HIYASRLFAGVASGAAFVVLPIFINEIAESREKAARLTFTIELWRTLGILIGFVLGFYVPYAFVN 175
             |..||:..||.:|.::..||:::.|:|....:....|.| |::..:|:.:..:  |.:.....|
Human   134 -IVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTMT-EVFVIVGVFLAQI--FSLQAILGN 194

  Fly   176 IVGCAVSFVFT--------MTFPFVQESPHYYL-RKNNMASLEKSLRWYRGIRDIDDREKPEYLS 231
            ..|..|....|        :|.||..|||.|.| :|.:.|:..::||..||..|::        :
Human   195 PAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKGDEATARQALRRLRGHTDME--------A 251

  Fly   232 ELNEFHAELRSRDKNVGSTPMSHGYIIR------LTFVSFLLTVCAKLSGVFVELNYAADFLGRT 290
            ||.:..||.|: ::..|...:.|...:|      |:.:  :|....:|||:.. :||.||    |
Human   252 ELEDMRAEARA-ERAEGHLSVLHLCALRSLRWQLLSII--VLMAGQQLSGINA-INYYAD----T 308

  Fly   291 GYST------ETNYVVLAS--AQCAGALLARLVGPRLPRKLLLCLSSLFAAAAVIALALFKAYGH 347
            .|::      .:.||.:.|  ......:.:.::..||.|:.||........:|.:.|.:      
Human   309 IYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHLLLAGYGICGSACLVLTV------ 367

  Fly   348 LWLLGNWADR--YLPIILLAIQLALVSFGLYPLAAVVSSEVLPTKLHDLLYSLASAVSWL----- 405
            :.|..|....  ||.||.:...:|..|.|..|:.:||.:|:.........:.:..||.||     
Human   368 VLLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMVDGAVHWLTNFII 432

  Fly   406 -LLFGMIEAFNAVKATIAPGLLLYLWV 431
             .||..|:...:.:|::...    .||
Human   433 GFLFPSIQGPTSGRASLCQS----SWV 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 37/156 (24%)
Sugar_tr 58..453 CDD:278511 101/416 (24%)
SLC2A7XP_011539126.1 Sugar_tr 26..441 CDD:278511 108/448 (24%)
MFS 100..439 CDD:119392 88/365 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.