DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and CDC48

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_010157.1 Gene:CDC48 / 851431 SGDID:S000002284 Length:835 Species:Saccharomyces cerevisiae


Alignment Length:432 Identity:114/432 - (26%)
Similarity:202/432 - (46%) Gaps:105/432 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 IDAQQYSSESSSQSGFGFRTAREQLIMDELKKK-------NRQATSEV-DAVPTGMMNFRKKTLG 194
            :|.:..::|:....|....:...:..|.::::|       ..:..:|| |::...|.||| ..||
Yeast   404 VDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDNFR-FALG 467

  Fly   195 GKRTVSSNFVSPVAQNDNSTSSRSSSIPPALAHLDSKMVDHILGESMHDFKPVAWEDIAGLESAK 259
                           |.|.::.|.:.:                 ||::    |.|:|:.||:..|
Yeast   468 ---------------NSNPSALRETVV-----------------ESVN----VTWDDVGGLDEIK 496

  Fly   260 STFLEAIIMPLRRPDLFT--GVRCPPRGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSK 322
            ....|.:..|:..||.:|  |: .|.:|||.:|||||||||:||::|::..|.|.|:....|.|.
Yeast   497 EELKETVEYPVLHPDQYTKFGL-SPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSM 560

  Fly   323 WVGDAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENE---STLRLKNEFLIHLDGAASNE 384
            |.|::|..::.:|..|.|..|.::|:||:||:...|..:..:   ::.|:.|:.|..:||  .|.
Yeast   561 WYGESESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDG--MNA 623

  Fly   385 EIRVLVIGATNRPQELDEAVRR--RFVRRLYVPLPTREARQKIIEKLIHQVKHNLDVR------- 440
            :..|.||||||||.::|.|:.|  |..:.:|||||...||..|:         |..:|       
Yeast   624 KKNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDENARLSIL---------NAQLRKTPLEPG 679

  Fly   441 -QVIELAELTDGYSGADVDTLCRYASMAPLRSLTPDQMEVIETHQ-------------------- 484
             ::..:|:.|.|:||||:..:.:.|:...::    |.:|....|:                    
Yeast   680 LELTAIAKATQGFSGADLLYIVQRAAKYAIK----DSIEAHRQHEAEKEVKVEGEDVEMTDEGAK 740

  Fly   485 ---------LPAVTMDDFKQALRVISKSVSSEDCKQFEAWNE 517
                     :|.:|.:.|.:|::...:|||..:.:::||:::
Yeast   741 AEQEPEVDPVPYITKEHFAEAMKTAKRSVSDAELRRYEAYSQ 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 57/140 (41%)
AAA 286..416 CDD:278434 53/134 (40%)
Vps4_C <480..520 CDD:286426 10/67 (15%)
CDC48NP_010157.1 CDC48 48..785 CDD:273521 114/432 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.