DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and IQCA1

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001257514.1 Gene:IQCA1 / 79781 HGNCID:26195 Length:830 Species:Homo sapiens


Alignment Length:526 Identity:101/526 - (19%)
Similarity:204/526 - (38%) Gaps:132/526 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ESMEKAMKERCQKKITMSRRTKRGITHAGYLFEMPHNSVFEPECRGFYESCQQTEMASSDLQAPA 106
            |...|..|::.:|:...:::.|:|.....                  .|..::.:|:.| |..||
Human   356 EEKNKKKKKKKEKQPKKAKKQKKGTKEKN------------------KEEDEKWKMSPS-LFLPA 401

  Fly   107 L-EVSSTYPVQQAVKSRPEGQFPESRNNSTKKIDAQQYSSESSSQSGFGFRTAREQLIMDELKKK 170
            : |..:.|  ::....:.|..      |.::..|.:....|...:.....|...::|:..|||..
Human   402 MKEGCNAY--KEIWMKKDESW------NFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNL 458

  Fly   171 NRQATSEVD-AVPTGMMNFRKKTLGGK---------------RTVSSNFVSPVAQ---------- 209
            ......|.: .|..|....:||...||               ||:.|.:...|.:          
Human   459 KLAVDRERERPVKAGKKKDKKKGKKGKKKEKKAKKDKDLTADRTIESLYKELVEEGLLIQALKVN 523

  Fly   210 -NDN-------STSSRSSSIPPALAHLDSKMVDHILG------ESMHDFKPVAWEDIAGLESAKS 260
             :|.       .|:.|..||.|..:.||.:.:..:.|      .::|:..|:.            
Human   524 LSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQLITLYGIWPLGSAAVHEKAPLV------------ 576

  Fly   261 TFLEAIIMPLRRPDLFTGVRCPPRGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVG 325
                                   :.:||.||.|.||.::..:|.::..|..|:::.|::..|:.|
Human   577 -----------------------KSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPG 618

  Fly   326 --DAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKR--SANENESTLRLKNEFLIHLDGAAS--NE 384
              ..:.::..:|.||...||::::|::.:....|:  :|.:.....|||.    ||.....  ..
Human   619 KNGLQMMLHAVFKVARQLQPSVVWIEDTEKTFYKKVPNAEKMNEPKRLKK----HLPQILKLLKP 679

  Fly   385 EIRVLVIGATNRPQELD-EAVRRRFVRRLYVPLPTREAR----QKIIEKLIHQVKHNLDVRQVIE 444
            :.|:|::|.|.||.:.: ::..:.:.:.:.||.|...:|    ::|||:....:...|:|..   
Human   680 DDRILIVGTTRRPFDAELQSFCKVYQKIILVPRPDYASRYVLWKQIIERNGGVLTSALNVSC--- 741

  Fly   445 LAELTDGYSGADVDTLCRYASMAPLRSLTPDQMEVIETHQLPAVTMDDFKQALRVISKSVSSEDC 509
            ||::|||::...:        :..::.:..||....:.|:  .:|..:|..|:..:: .|..|:.
Human   742 LAKVTDGFTQGHI--------VEVVKGVLTDQRIRRQIHK--PLTAVEFITAITSMN-PVYKEEE 795

  Fly   510 KQFEAW 515
            :.|:.|
Human   796 ESFKNW 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 34/142 (24%)
AAA 286..416 CDD:278434 33/136 (24%)
Vps4_C <480..520 CDD:286426 8/36 (22%)
IQCA1NP_001257514.1 SpoVK <497..796 CDD:223540 69/351 (20%)
AAA 579..712 CDD:278434 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.