DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and pex1

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001164306.1 Gene:pex1 / 793906 ZFINID:ZDB-GENE-070530-1 Length:1237 Species:Danio rerio


Alignment Length:371 Identity:113/371 - (30%)
Similarity:181/371 - (48%) Gaps:49/371 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 REQLIMDELKKKN---RQATSEVDAVPTGMMNFRKKTLG--GKRTVSSNFVSPVAQNDNSTSSR- 217
            |.:::...:.||:   .|.|.::|:|......|..:.|.  .:|.:.:|    ...|....|.: 
Zfish   709 RVEILKSLIVKKSFQVCQTTLDLDSVAKETEGFMARDLNLLLERAIHAN----TLHNSEDLSCKD 769

  Fly   218 -----SSSIPPAL--AHLDSKMVDHILGESMHDFKPVAWEDIAGLESAKSTFLEAIIMPLRRPDL 275
                 ....||:|  |.|.:..     |..|        |.|.||..|:...::.|::|.:.|.|
Zfish   770 FRQALQGFTPPSLWDAQLQAPS-----GAGM--------ERIGGLHEARQLLMDIILLPAKYPLL 821

  Fly   276 FTGV---RCPPRGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVGDAEKLVKTLFAV 337
            |:.:   :|  .||||:|.|||||||:|.::|.::...|.||....|.||::|.:|:.|:.:|..
Zfish   822 FSSLPLRQC--SGVLLYGAPGTGKTLLAGAVAKESGMNFISIKGPELLSKYIGASEQAVRDVFQR 884

  Fly   338 AAAHQPAIIFIDEVDSLLSKRSANENESTLRLKNEFLIHLDGAASNEEIR-VLVIGATNRPQELD 401
            |...:|.|:|.||.|||..:|..:....|.|:.|:.|..|||.   |.:. |.|:.|::||..:|
Zfish   885 AQQAKPCILFFDEFDSLAPRRGHDNTGVTDRVVNQLLTQLDGV---EGLTGVYVLAASSRPDLID 946

  Fly   402 EAVRR--RFVRRLYVPLPTREARQKIIEKLIHQVKHNLDVRQVIELAELTDGYSGADVDTLCRYA 464
            .|:.|  |..:.||.|.|.||||.:|:..|.|.|....|| .:.::|..|:.::|||:..|...|
Zfish   947 PALLRPGRLDKSLYCPPPDREARLEILRALTHSVPLAADV-DLDQIAGATELFTGADLKALLYNA 1010

  Fly   465 SMAPLR-SLTPDQMEVIETHQLPAVTMDDFK-QALRVISKSVSSED 508
            .:..:. ||.|:.:     |.|.:.:..|.. .:|..::.|..|:|
Zfish  1011 QLEAIHSSLGPNLL-----HDLGSGSDSDVSLSSLIFLNHSSGSDD 1051

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 54/138 (39%)
AAA 286..416 CDD:278434 52/132 (39%)
Vps4_C <480..520 CDD:286426 7/30 (23%)
pex1NP_001164306.1 PEX-2N 12..89 CDD:286362
PEX-1N 101..171 CDD:286361
SpoVK 559..1026 CDD:223540 106/344 (31%)
P-loop_NTPase 559..686 CDD:304359
AAA 833..962 CDD:278434 52/131 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.