DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and spata5l1

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001070056.2 Gene:spata5l1 / 767648 ZFINID:ZDB-GENE-060929-204 Length:748 Species:Danio rerio


Alignment Length:327 Identity:112/327 - (34%)
Similarity:171/327 - (52%) Gaps:52/327 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 ALAHLDSKMVDHILGESMHDFKPVAWEDIAGLESAKSTFLEAIIMPLRRPDLFT--GVRCPPRGV 286
            ||.|:....:...:|.:  ||||:.||.|.|||..|....::|..|:|.|:.|.  || ..||||
Zfish   428 ALRHVQPSCLRSSIGAT--DFKPIGWEQIGGLEDVKLKLKQSIEWPMRFPEAFVRLGV-SRPRGV 489

  Fly   287 LLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDEV 351
            ||:||||..||.:.|:.||.:...|||::.:.|.|.:|||:||.:..|||.|.|..|:|:|:|||
Zfish   490 LLYGPPGCAKTTLVKAAASSSHCSFFSLSGAELFSPYVGDSEKTLAQLFAQARACAPSIVFLDEV 554

  Fly   352 DSLLSKR---SANENESTLRLKNEFLIHLDG-------------------AASNEEIR------- 387
            ||::..|   |::.:....::.:..|..|||                   ....|::|       
Zfish   555 DSMVGSREDGSSSSHSVQSQVLSVLLTELDGVGVRTLERRSTCRKIALLEGGDQEDVRLHQMELQ 619

  Fly   388 ------VLVIGATNRPQELDEAVRR--RFVRRLYVPLPTREARQKIIEKLIHQVKHNLDVRQVIE 444
                  ||::.|||||:.||.|:.|  |..:.:|||.|..:||..::......|..:.|| .:.:
Zfish   620 EVCNKDVLIVAATNRPEALDSALLRPGRLDQIIYVPPPDLQARLAVLRICTKSVPLHQDV-CLED 683

  Fly   445 LAELTDGYSGADVDTLCRYASMAPLRSLTPDQMEVIETHQLPAVTMDDFKQALRVISKSVSSEDC 509
            ||..|:.:||||::.||:.|::..||.   |.:.|      ..|....|.:||:::|.|:|:|..
Zfish   684 LAAQTELFSGADLENLCKEAALLALRE---DGLAV------SCVRQKYFLKALQMLSPSLSAEQL 739

  Fly   510 KQ 511
            :|
Zfish   740 QQ 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 61/172 (35%)
AAA 286..416 CDD:278434 57/166 (34%)
Vps4_C <480..520 CDD:286426 9/32 (28%)
spata5l1NP_001070056.2 CDC48 13..740 CDD:273521 111/324 (34%)
AAA 224..357 CDD:278434
AAA 489..655 CDD:278434 56/165 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.