DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and VCP

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens


Alignment Length:398 Identity:118/398 - (29%)
Similarity:195/398 - (48%) Gaps:57/398 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 IDAQQYSSESSSQSGFGFRTAREQLIMDELKKKNRQATSEVDAVPTGMMNFRKKTLGGKRTVSSN 202
            :|.:|.::|:....|........:..:..::||......|.:.:...:||....|:         
Human   394 VDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTM--------- 449

  Fly   203 FVSPVAQNDNSTSSRSSSIPPALAHLDSKMVDHILGESMHDFKPVAWEDIAGLESAKSTFLEAII 267
                    |:...:.|.|.|.||.            |::.:...|.||||.|||..|....|.:.
Human   450 --------DDFRWALSQSNPSALR------------ETVVEVPQVTWEDIGGLEDVKRELQELVQ 494

  Fly   268 MPLRRPDLFT--GVRCPPRGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVGDAEKL 330
            .|:..||.|.  |: .|.:|||.:||||.||||:||:||::.:|.|.||....|.:.|.|::|..
Human   495 YPVEHPDKFLKFGM-TPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEAN 558

  Fly   331 VKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENE---STLRLKNEFLIHLDGAASNEEIRVLVIG 392
            |:.:|..|....|.::|.||:||:...|..|..:   :..|:.|:.|..:||.::.:  .|.:||
Human   559 VREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKK--NVFIIG 621

  Fly   393 ATNRPQELDEAVRR--RFVRRLYVPLPTREARQKIIEKLIHQ--VKHNLDVRQVIELAELTDGYS 453
            |||||..:|.|:.|  |..:.:|:|||..::|..|::..:.:  |..::|:.   .||::|:|:|
Human   622 ATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLE---FLAKMTNGFS 683

  Fly   454 GADVDTLCRYASMAPL-------------RSLTPDQMEVIETHQLPAVTMDDFKQALRVISKSVS 505
            |||:..:|:.|....:             |...|..|||.|...:|.:..|.|::|:|...:|||
Human   684 GADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVS 748

  Fly   506 SEDCKQFE 513
            ..|.:::|
Human   749 DNDIRKYE 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 55/140 (39%)
AAA 286..416 CDD:278434 51/134 (38%)
Vps4_C <480..520 CDD:286426 11/34 (32%)
VCPNP_009057.1 CDC48 25..764 CDD:273521 118/398 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.