DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and PEX6

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_000278.3 Gene:PEX6 / 5190 HGNCID:8859 Length:980 Species:Homo sapiens


Alignment Length:278 Identity:99/278 - (35%)
Similarity:150/278 - (53%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VAWEDIAGLESAKSTFLEAIIMPLRRPDLFT-GVRCPPRGVLLFGPPGTGKTLIAKSIASQAKAK 310
            |:|.|:.||:..|...||.|.:||..|:|.: |:|  ..|:||.|||||||||:||::|::....
Human   702 VSWHDVGGLQEVKKEILETIQLPLEHPELLSLGLR--RSGLLLHGPPGTGKTLLAKAVATECSLT 764

  Fly   311 FFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENESTL--RLKNEF 373
            |.|:....|.:.:||.:|:.|:.:||.|.|..|.|||.||:|||...|..:.:...:  |:.::.
Human   765 FLSVKGPELINMYVGQSEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQL 829

  Fly   374 LIHLDGAASNEEIRVLVIGATNRPQELDEAVRR--RFVRRLYVPLPTREARQ-KIIEKLIHQVKH 435
            |..|||..|.::  |.||||||||..||.|:.|  ||.:.::|......|.| :::..:..:.|.
Human   830 LAELDGLHSTQD--VFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKL 892

  Fly   436 NLDVRQVIELAELTDGYSGADVDTLCRYASMAPLRSLTPDQMEVIETHQLPA-----VTMDDFKQ 495
            ...|..|..|.......:|||:.:||..|..|.|:....|..|.:|    |.     :||:|..|
Human   893 EPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLE----PGSSALMLTMEDLLQ 953

  Fly   496 ALRVISKSVSSEDCKQFE 513
            |...:..|||.::..:::
Human   954 AAARLQPSVSEQELLRYK 971

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 58/139 (42%)
AAA 286..416 CDD:278434 57/133 (43%)
Vps4_C <480..520 CDD:286426 10/39 (26%)
PEX6NP_000278.3 SpoVK 463..967 CDD:223540 99/272 (36%)
AAA 466..594 CDD:278434
AAA 743..871 CDD:278434 54/129 (42%)
Vps4_C 918..977 CDD:286426 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.