DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and NSF

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_006169.2 Gene:NSF / 4905 HGNCID:8016 Length:744 Species:Homo sapiens


Alignment Length:414 Identity:113/414 - (27%)
Similarity:181/414 - (43%) Gaps:82/414 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ESRNNSTKKIDA---QQYSSESSS---QSGFGFRTAREQLIMDELKK------KNRQATSEVDAV 181
            :|....|.|:.|   ||:::::.|   |..|.|......|::.:::.      |...||.:...:
Human   108 DSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKI 172

  Fly   182 PTGMMNFRKKTLGGKRTVSS-NFVSPVAQNDNSTSSRSSSIPPALAHLDSKMVDHILGESMHDFK 245
            ..|::....:....|...|| |.:......:|    |.|.|.|                      
Human   173 EVGLVVGNSQVAFEKAENSSLNLIGKAKTKEN----RQSIINP---------------------- 211

  Fly   246 PVAWE----DIAGLESAKS-TFLEAIIMPLRRPDLFTGVRCP-PRGVLLFGPPGTGKTLIAKSIA 304
              .|.    .|.||:...| .|..|....:..|::...:.|. .:|:||:||||.||||:|:.|.
Human   212 --DWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIG 274

  Fly   305 SQAKAKFFS-INPSSLTSKWVGDAEKLVKTLFAVAAAHQPA--------IIFIDEVDSLLSKRSA 360
            ....|:... :|...:.:|:||::|..::.|||.|...|..        ||..||:|::..:|.:
Human   275 KMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGS 339

  Fly   361 NENESTLR--LKNEFLIHLDGAASNEEI-RVLVIGATNRPQELDEAVRR--RFVRRLYVPLPTRE 420
            ....:.:.  :.|:.|..:||.   |:: .:||||.||||..:|||:.|  |...::.:.||..:
Human   340 MAGSTGVHDTVVNQLLSKIDGV---EQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEK 401

  Fly   421 ARQKIIEKLIHQVK---HNL---DVRQVIELAELTDGYSGADVDTLCRYA-SMAPLRSLTPD--- 475
            .|.:|:.  ||..:   |.|   || .:.|||..|..:|||:::.|.|.| |.|..|.:...   
Human   402 GRLQILH--IHTARMRGHQLLSADV-DIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKV 463

  Fly   476 --QMEVIETHQLPAVTMDDFKQAL 497
              .||..|:.|   ||..||..:|
Human   464 EVDMEKAESLQ---VTRGDFLASL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 49/150 (33%)
AAA 286..416 CDD:278434 47/143 (33%)
Vps4_C <480..520 CDD:286426 7/18 (39%)
NSFNP_006169.2 CDC48_N 6..83 CDD:215012
CDC48_2 111..>159 CDD:308534 10/47 (21%)
SpoVK <142..490 CDD:223540 103/380 (27%)
AAA 538..670 CDD:214640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.