DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and Nsf2

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster


Alignment Length:445 Identity:110/445 - (24%)
Similarity:189/445 - (42%) Gaps:89/445 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 STYPVQQAVKSRP---------------EGQFPESRNNSTKKIDAQQYSSESSSQ-SGFGFRTAR 159
            :|..:.|.:..||               |..|.:.:..:.:..|:.:.:.|...| :|......:
  Fly    76 ATLSINQEIDVRPYRFDASADIITLVSFETDFLQKKTTTQEPYDSDEMAKEFLMQFAGMPLTVGQ 140

  Fly   160 EQLIMDELKKKNRQATSEVDAVPTGMMNFRKKTLGGKRTVSSN------FVSPVAQNDNSTSSRS 218
            ..:...:.||....|...::||.       .:|:|.....:.|      ..:.|.|.:.:.:|  
  Fly   141 TLVFQFKDKKFLGLAVKTLEAVD-------PRTVGDSLPKTRNVRFGRILGNTVVQFEKAENS-- 196

  Fly   219 SSIPPALAHLDSKMVDHILGESM----HDFKPVAWEDIAGLESA-KSTFLEAIIMPLRRPDLF-- 276
                  :.:|..:....|:.:|:    .||..:.   |.||:.. .:.|..|....:..|:|.  
  Fly   197 ------VLNLQGRSKGKIVRQSIINPDWDFGKMG---IGGLDKEFNAIFRRAFASRVFPPELVEQ 252

  Fly   277 TGVRCPPRGVLLFGPPGTGKTLIAKSIASQAKAKFFSI-NPSSLTSKWVGDAEKLVKTLFAVAAA 340
            .|:: ..:|:||:|||||||||:|:.|.:...|:...| |...:..|:||::|..::.|||.|..
  Fly   253 LGIK-HVKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLFAEAEE 316

  Fly   341 HQPA--------IIFIDEVDSLLSKRSANENESTLR--LKNEFLIHLDGAASNEEI-RVLVIGAT 394
            .:..        ||..||:|::...|.:....|.:.  :.|:.|..:||.   |:: .:||||.|
  Fly   317 EEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGV---EQLNNILVIGMT 378

  Fly   395 NRPQELDEAVRR--RFVRRLYVPLPTREARQKIIEKLIHQVKHNLDVRQVI------ELAELTDG 451
            ||...:|||:.|  |...::.:.||..:.|.:|:.  || .|...|..::.      |:|..|..
  Fly   379 NRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILN--IH-TKRMRDFNKIASDVDNNEIAAKTKN 440

  Fly   452 YSGADVDTLCRYASMAPLRSL---------TPDQMEVIETHQLPAVTMDDFKQAL 497
            :|||:::.|.|.|....:..|         .|:.||.:.      ||..||..||
  Fly   441 FSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLR------VTRADFLHAL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 50/149 (34%)
AAA 286..416 CDD:278434 48/143 (34%)
Vps4_C <480..520 CDD:286426 6/18 (33%)
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012 3/12 (25%)
CDC48_2 117..>170 CDD:215011 11/59 (19%)
AAA 259..404 CDD:214640 50/147 (34%)
AAA 261..402 CDD:278434 48/143 (34%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.