DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and trip13

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_956876.1 Gene:trip13 / 393554 ZFINID:ZDB-GENE-040426-1488 Length:424 Species:Danio rerio


Alignment Length:239 Identity:70/239 - (29%)
Similarity:114/239 - (47%) Gaps:28/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 WEDIAGLESAKSTFLEAIIMPLRRPD--LFTGVRCPPRGVLLFGPPGTGKTLIAKSIASQ----- 306
            ||.:...|..|:..|:.:...:...|  :.:.:....|.|||.||||||||.:.|.:|.:     
Zfish   128 WESLIYEEGIKTQLLDYVSTTIFFSDKNVDSNLIAWNRVVLLHGPPGTGKTSLCKGLAQKLSIRL 192

  Fly   307 ----AKAKFFSINPSSLTSKWVGDAEKLVKTLFAVAAA---HQPAIIF--IDEVDSLLSKRSA-- 360
                |.::|..||..||.|||..::.|||..:|.....   .:.|::|  ||||:||.:.|||  
Zfish   193 SDRYAHSQFVEINSHSLFSKWFSESGKLVTKMFQKIQELIDDKDALVFVLIDEVESLTAARSAAQ 257

  Fly   361 --NENESTLRLKNEFLIHLDGAASNEEIRVLVIGATNRPQELDEAVRRRFVRRLYVPLPTREARQ 423
              .|....:|:.|..|..||....:.  .|:::..:|..:::|.|...|...:.|:..|:.:|..
Zfish   258 AGTEPSDAIRVVNSVLTQLDQIKRHP--NVVILTTSNVTEKIDLAFVDRADIKQYIGPPSAKAIF 320

  Fly   424 KI-IEKLIHQVKHNL--DVRQVIELAEL-TDGYSGADVD--TLC 461
            .| :..|...:|..:  ..:|::.|.|| |..:..:||.  :||
Zfish   321 NIYLSSLEELMKRQIIYPRQQLVSLEELETMNFMESDVTRLSLC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 50/153 (33%)
AAA 286..416 CDD:278434 49/147 (33%)
Vps4_C <480..520 CDD:286426
trip13NP_956876.1 AAA 164..314 CDD:214640 50/151 (33%)
AAA 167..312 CDD:278434 49/146 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.