DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and IQCA1L

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001291348.1 Gene:IQCA1L / 392843 HGNCID:22831 Length:818 Species:Homo sapiens


Alignment Length:537 Identity:115/537 - (21%)
Similarity:221/537 - (41%) Gaps:119/537 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSKLLLICQQTRSSSESIHFAALKDHHARLQACESMEKAMKERCQKKITMSRRTKRGITHAGYLF 73
            |.:|.:..|:.|...:.                :|.||...|: :||.....:.|:|...|  :.
Human   338 RMELEMQMQENRKKEQE----------------KSKEKGKDEK-EKKKGKEEKAKKGEVDA--VL 383

  Fly    74 EMPHNSVFEPECRGFYESCQQTEMASSDLQAPALEVSSTYPVQQAVKSRPEGQFPESRNNSTKKI 138
            ::..:......|.| :|                 |..:|:      |:|.|...|      ::..
Human   384 QVLPSKCIPMICAG-HE-----------------EYLNTW------KNRCESIHP------SQNY 418

  Fly   139 DAQQYSSESSSQSGFGFRTAREQLIMDELKKKNRQATSEVDAVPTGMMNFRKKTLGGKRTVSSNF 203
            |::....|...:.....|...::|:..||:|. |.|..:.:..|   :...||| .||:|...  
Human   419 DSETLREEKRKEVELEIRIQVDELMRQELRKL-RLAVDKEEERP---LRAPKKT-PGKKTGKK-- 476

  Fly   204 VSPVAQNDNSTSSRSSSIPPALAHLDSKMVDHILGESMHDFKPVAWEDIAG----LESAKSTFLE 264
                 :..:.||.||         ::|...:.::...:...:.||.:|..|    |.|..| .::
Human   477 -----KEKDLTSDRS---------VESLYEELVISGLLRKSESVALKDYIGDFLYLGSTLS-LVK 526

  Fly   265 AIIMP----------------LRRPDLFTGVRCP-PRGVLLFGPPGTGKTLIAKSIASQAKAKFF 312
            .:.||                |..||:.  :..| .|.:||.||.|.||.::.|::.::..|..|
Human   527 KLPMPSLFDIRQNVALYAVLRLGSPDIH--IMAPLIRSILLVGPSGMGKKMLVKAVCTETGANLF 589

  Fly   313 SINPSSLTSKWVG--DAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENE--STLRLKNEF 373
            .::|.:|..|:.|  .|:.:|..:|.||...||::|:|...:....|::..|::  ...|:|.:.
Human   590 DLSPENLLGKYPGRNGAQMMVHIVFKVARLLQPSVIWIGNAEKNFYKKTPKEDKEMDPKRIKKDL 654

  Fly   374 LIHLDGAASNEEIRVLVIGATNRPQELD-EAVRRRFVRRLYVPLPTREARQKIIEKLIH----QV 433
            ...|......:  ||::||.|:|||..: ..:.|.:.|.|::|.|...:|..:.:::|.    |.
Human   655 TKALRLLTPGD--RVMLIGTTSRPQLAEMRGLCRVYERILFMPRPDYASRYVLWKRMIEARGIQP 717

  Fly   434 KHNLDVRQVIELAELTDGYSGADVDTLCRYASMAPLRSLTPDQMEVIETHQLPAVTMDDFKQALR 498
            ..:||:.   .||:::|||:...:        :..::|:..:: ..::..:.|.|..:...|.::
Human   718 TQHLDIS---ALAKVSDGYTPGHI--------LQAIQSVLSER-RFLQLSKRPLVASEFLGQLVK 770

  Fly   499 VISKSVSSEDCKQFEAW 515
            :  ..|..|:.:..:.|
Human   771 L--DPVYREEEESLKDW 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 42/141 (30%)
AAA 286..416 CDD:278434 39/134 (29%)
Vps4_C <480..520 CDD:286426 6/36 (17%)
IQCA1LNP_001291348.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..377 9/49 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..482 7/34 (21%)
SpoVK <561..734 CDD:223540 51/177 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 795..818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.