DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and CG10793

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:498 Identity:136/498 - (27%)
Similarity:231/498 - (46%) Gaps:67/498 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CQKKITMSRRTKRGITHAGYLFEMPHNSVFEPECRGFYESCQ----------QTEMASS-DLQAP 105
            |:.....|.| :|.|.:      :.|..:.|   .|:|.|.:          :.|:..: ||.|.
  Fly    19 CEDVRNFSTR-RRNILY------LMHRYLVE---NGYYASAESLKSEGRLTDEYELCDNIDLDAM 73

  Fly   106 ALEVSSTYPVQQAVKSRPEGQFPESRNNSTKKIDAQQYSSESSSQSGFGFRTAREQLIMDELKKK 170
            .||.:|.|.::       .|::|:.......||..:           .|...|.|:....||.||
  Fly    74 YLEYASFYNMK-------FGKYPKILKKVGAKIKVE-----------MGGGKAHEKTPAKELPKK 120

  Fly   171 NRQATSEVDAVPTGMMNFRKKTLGGKRTVSSNFVSPVAQNDNSTSSRSSSIPPALAHL----DSK 231
                ....||   .:.|:........:.:|:.....:.:.:.:|.|........:.|:    |..
  Fly   121 ----PPTTDA---SLANWHIGVGAATQALSNEQPLQIKKMETATESNGQDNACEIEHVHLGGDDV 178

  Fly   232 MVDHILGESMHDFK---------PVAWEDIAGLESAKSTFLEAIIMPLRRPDLFTGVRCPPRGVL 287
            :...:..:|:.:..         .:.|.|:.|.:.|.....||::.|:..|.||.....|.|.:|
  Fly   179 LFSSLEWQSLAELVKTSILQENIKIKWSDVCGNQRAIELIKEAVLTPIEFPQLFAHGLKPWRSLL 243

  Fly   288 LFGPPGTGKTLIAKSIAS--QAKAKFFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDE 350
            |.||||:||||:||::.|  |.:..||:|..|.:.|||.|::||:::.||.:||...|::||.||
  Fly   244 LHGPPGSGKTLLAKALYSETQGQVTFFNITASIMVSKWRGESEKILRVLFHMAAKRAPSVIFFDE 308

  Fly   351 VDSLLSKRS-ANENESTLRLKNEFLIHLDGAASNEEIRVLVIGATNRPQELDEAVRRRFVRRLYV 414
            ::||.|||. |.::||:.|.|||.|..|||...:.. .|.|:.:||.|.::|||..|||.::|.|
  Fly   309 IESLTSKRDRATDHESSKRFKNELLQLLDGMEHSLN-GVFVLASTNLPWDIDEAFLRRFEKKLLV 372

  Fly   415 PLPTREARQKIIEKLIHQVKHNLDVRQVIELAELTDGYSGADVDTLCRYASMAPLRSLTP--DQM 477
            .||....|..:|.:|:.. ..:|:.|.:.:|.|::|.::|.::...|:..||..:|..|.  |:.
  Fly   373 QLPNAAERSCLINRLLGS-SISLNPRLLEQLVEISDHFTGDEIRLACKEISMHRVRCATKIGDRS 436

  Fly   478 EVIETHQLPAVTMDDFKQALRVISKSVSSEDCKQFEAWNEIYG 520
            ..:...:.||....:.::|.|.: :.:..:...:.|.|.:..|
  Fly   437 IGLLAKESPAAIEANVEKAFRQV-RPLGQKLLAKHEQWQQENG 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 65/138 (47%)
AAA 286..416 CDD:278434 62/132 (47%)
Vps4_C <480..520 CDD:286426 6/39 (15%)
CG10793NP_570054.2 LisH 31..56 CDD:285685 6/33 (18%)
P-loop_NTPase 205..>259 CDD:304359 24/53 (45%)
AAA 238..376 CDD:214640 65/138 (47%)
AAA 242..374 CDD:278434 62/132 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23074
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.