DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and Nvl

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001099450.1 Gene:Nvl / 289323 RGDID:1311270 Length:855 Species:Rattus norvegicus


Alignment Length:277 Identity:96/277 - (34%)
Similarity:154/277 - (55%) Gaps:14/277 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VAWEDIAGLESAKSTFLEAIIMPLRRPDLFTGV-RCPPRGVLLFGPPGTGKTLIAKSIASQAKAK 310
            |.|.|:..||..:.....||:.|:|.|:.|..: ...|.||||.||||.||||:||::|:::...
  Rat   577 VTWADVGALEDIREELTMAILAPVRNPEQFRALGLVAPAGVLLAGPPGCGKTLLAKAVANESGLN 641

  Fly   311 FFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENESTLRLKNEFLI 375
            |.|:....|.:.:||::|:.|:.:|..|....|.:||.||||:|..:||..|..:::|:.|:.|.
  Rat   642 FISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLT 706

  Fly   376 HLDGAASNEEIRVLVIGATNRPQELDEAVRR--RFVRRLYVPLPTREARQKIIEKLI-HQVKHNL 437
            .:||..:.::  |.::.|||||..:|.|:.|  |..:.|:|.||....|..|::.:. :..|..|
  Rat   707 EMDGLETRQQ--VFILAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRVAILKTITKNGTKPPL 769

  Fly   438 DVRQVIELAELT-----DGYSGADVDTLCRYASMAPLRSLTPDQMEVIETHQLPAVTMDDFKQAL 497
            |  :.::|..:.     |.|:|||:..|.|.||:..||.....|...|.|.:| .|:...|::|.
  Rat   770 D--EDVDLEAIANDHRCDCYTGADLSALVREASLCALRQEITGQKNGIGTAEL-TVSHKHFEEAF 831

  Fly   498 RVISKSVSSEDCKQFEA 514
            |.:..|:|.:|.:.:||
  Rat   832 RKVKPSISVKDQRMYEA 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 54/137 (39%)
AAA 286..416 CDD:278434 51/131 (39%)
Vps4_C <480..520 CDD:286426 12/35 (34%)
NvlNP_001099450.1 Nucleolin_bd 2..71 CDD:406995
CDC48 <255..855 CDD:273521 96/277 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.