DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fign and CG31495

DIOPT Version :9

Sequence 1:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001287320.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster


Alignment Length:234 Identity:50/234 - (21%)
Similarity:93/234 - (39%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 LLFGPPGTGKTLIAKSIASQAKAKFFS-INPSSLTSKWVGDAEKL--VKTLFAVAAAHQPAIIFI 348
            |:.|.|.:|.|.:|..:|.:....|.. |:.:.|..  :.|:||.  ::.:...|...:.:.:.|
  Fly   129 LVEGKPKSGLTTVAAQMALKTDCPFIKYISSAELLG--LSDSEKCQRIREVLEDAYVSRRSCVII 191

  Fly   349 DEVDSL-----LSKRSANE--NESTLRLKNEFLIHLDGAASNEEIRVLVIGATNRPQELDE-AVR 405
            |:.:.:     |.||.:.|  .:.|:.||.:       ..::.|:  ::|..:||...|:| .:.
  Fly   192 DDFERVIGYGALGKRYSKEFLQKLTVLLKKQ-------PPNSHEL--IIICTSNRLDVLEELGLL 247

  Fly   406 RRFVRRLYVP--------LPTREARQKIIEKLIHQVKHNLDVRQV-IELAELTDGYSGADVDTLC 461
            ..|.....||        :...||.::...:.:.|::..:|.|.| |.:..|.|           
  Fly   248 SVFTSVHNVPNVSTPKELMVIVEASKRFEPEELRQIEIAMDGRNVSIGIKRLLD----------- 301

  Fly   462 RYASMAPLRSLTPDQ------------MEVIETHQLPAV 488
               .:|.:.||.||:            |..:..|..|.|
  Fly   302 ---LIAWVNSLNPDRRAAKLLKKLGEAMGWVGNHSSPLV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FignNP_001259995.1 AAA 282..418 CDD:214640 32/149 (21%)
AAA 286..416 CDD:278434 32/147 (22%)
Vps4_C <480..520 CDD:286426 3/9 (33%)
CG31495NP_001287320.1 AAA 129..259 CDD:214640 32/140 (23%)
P-loop_NTPase 129..257 CDD:304359 30/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.