DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and FGFRL1

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:XP_024309860.1 Gene:FGFRL1 / 53834 HGNCID:3693 Length:527 Species:Homo sapiens


Alignment Length:472 Identity:85/472 - (18%)
Similarity:147/472 - (31%) Gaps:170/472 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVLILLLVL-VRNAVGQAPRENATNPTLISLV----------RSSEKEPEQMESH---RYVTGLS 61
            |.:|.:||: |.:..|||  |...:|.|:.|:          .::.:.|.:|...   |.|..|.
Human     5 ITMINVLVIPVTSRSGQA--EMTPSPLLLLLLPPLLLGAFPPAAAARGPPKMADKVVPRQVARLG 67

  Fly    62 EPIAME-PLTRMRLNPNPDGEITELTTNVTLYMEKIPRLQVRWQ--DNLPQG------------- 110
            ..:.:: |:..   :|.|          :|::.:....:...|.  ..||||             
Human    68 RTVRLQCPVEG---DPPP----------LTMWTKDGRTIHSGWSRFRVLPQGLKVKQVEREDAGV 119

  Fly   111 -------------TSYNVLV----SAVNNSRCPDAPCSEYGIKEKNASAE-------------TH 145
                         .:|.::|    |....|..||   |..|.:|..||.:             ..
Human   120 YVCKATNGFGSLSVNYTLVVLDDISPGKESLGPD---SSSGGQEDPASQQWARPRFTQPSKMRRR 181

  Fly   146 SVNLPVNPNLNVESV-------DCNYMFGCQYQVIVETSNAMVRRSARVYIPQCLE--------- 194
            .:..||..::.::.|       |..:|         :...|:.|       |:..|         
Human   182 VIARPVGSSVRLKCVASGHPRPDITWM---------KDDQALTR-------PEAAEPRKKKWTLS 230

  Fly   195 ---------GKCSCQLAPTPPKVLAVAKMLSNETISINLSILASELLRKEQDSHLHETL------ 244
                     ||.:|:              :||...:||.:.....:.|......|..|.      
Human   231 LKNLRPEDSGKYTCR--------------VSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTV 281

  Fly   245 ---RTYKMQLKINEETNPSLPWGGVLKHLMTRVYKLSELNFRAT-PKGFEGVMKLGLGTQLKEKA 305
               .|...|.|:..:..|.:.|       :.||...:|....:| ..|.:..:.|..|.......
Human   282 DFGGTTSFQCKVRSDVKPVIQW-------LKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPD 339

  Fly   306 SLSLQAVII-----DPTG---CEGPRS---------VTKVPVPANPVLLTEGDSVSNSI---IVM 350
            ...|..::|     |..|   |.|..:         :|.:|.|..|.......|.:.|:   :|:
Human   340 GSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATSLPWPVVI 404

  Fly   351 SAMLIAIILAGLIMLLL 367
            .....|:.:.|.::|.|
Human   405 GIPAGAVFILGTLLLWL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568
PTKc 430..763 CDD:270623
FGFRL1XP_024309860.1 I-set 56..139 CDD:254352 13/95 (14%)
Ig2_FGFRL1-like 180..261 CDD:143264 16/110 (15%)
Ig 284..378 CDD:325142 18/100 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.