DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and fgfrl1a

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_956670.1 Gene:fgfrl1a / 393347 ZFINID:ZDB-GENE-040128-2 Length:483 Species:Danio rerio


Alignment Length:466 Identity:83/466 - (17%)
Similarity:150/466 - (32%) Gaps:182/466 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 VYIPQCLEGKCSCQLAPTPPKVLAVAKMLSNETISINLSILASELLRKEQDSHLHETLRTYKMQL 251
            ::|..|..|         ||:|  ..|:...:|:.|.                     ||.|:|.
Zfish    14 IFITDCARG---------PPRV--AEKIAHRQTVRIG---------------------RTMKLQC 46

  Fly   252 KINEETNPSLPW---------GGVLKHLMTRVYKLSELN--------FRATPKGFEGVMKLGLGT 299
            .:..:..|.:.|         |.:...::.:..::.|:.        .:|| .||..|       
Zfish    47 PVEGDPPPLIMWTKDGRNIHSGWMRFRVLQQALRIKEVEADDAGTFICKAT-NGFGSV------- 103

  Fly   300 QLKEKASLSLQAVIIDPT--GCEGPRSVTKVPVPANPVLLTEGDSVSNSIIVMSAMLIAIILAGL 362
                  :::...::||.:  |.||.|       ||..   ||               .:..|.|.
Zfish   104 ------NINYTLIVIDDSSAGREGAR-------PAGE---TE---------------YSTDLTGK 137

  Fly   363 IMLLLRRRRARTTAKLRKQEQIYIQTFATSAIEMEDNVNYVDKYVEKSQVLGLADIFEVPHSAIQ 427
            ::    |.|....||:||:   .|.....|::.::...:...:          .||..:..|...
Zfish   138 LV----RPRFTQPAKMRKR---VIARPVGSSVRLKCTASGNPR----------PDIVWLKDSRPL 185

  Fly   428 IGRMLGEGAFGQVHEATAINLRRMRGTTIVAVKQLKP----------NPKADEV-AEYLAEIEML 481
            ....:|||             |:.:.|  :::|.|.|          :.:|.|: |.|..|:...
Zfish   186 TPEEVGEG-------------RKKKWT--LSLKNLTPEHSGKYTCHVSNRAGEINATYKVEVIQR 235

  Fly   482 KG-----VGTH--HNVVSFLGC----CTIK---PPYLMIMEYVNKGNLLSYLRTV---------- 522
            ..     .|||  :..|.:.|.    |.::   .|.:..::.|..|....|..|:          
Zfish   236 TNSKPILTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRVEPGGEGKYNSTIEVGDHHFVVL 300

  Fly   523 -------RKEASKLRNRNANYTSCRPIMTRTNSTSSPKSQSVNYIELKASSQTIEMPQEDSTAHM 580
                   |.:.|.|.         :.::||     :.:..:..||.|.|::    |.....:|.:
Zfish   301 PTGDVWSRPDGSYLN---------KLLITR-----AKEEDAGMYICLGANT----MGYSFRSAFL 347

  Fly   581 NGIRQPHPSFA 591
            ..:..|.|.|:
Zfish   348 TVLPDPKPPFS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568 38/208 (18%)
PTKc 430..763 CDD:270623 38/204 (19%)
fgfrl1aNP_956670.1 I-set 32..111 CDD:254352 15/113 (13%)
IGc2 38..101 CDD:197706 12/84 (14%)
I-set 141..232 CDD:254352 22/118 (19%)
Ig2_FGFRL1-like 151..232 CDD:143264 18/108 (17%)
I-set 245..349 CDD:254352 21/121 (17%)
Ig 255..350 CDD:299845 18/112 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.