DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and pdgfrl

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_956608.2 Gene:pdgfrl / 393284 ZFINID:ZDB-GENE-040426-901 Length:371 Species:Danio rerio


Alignment Length:300 Identity:56/300 - (18%)
Similarity:105/300 - (35%) Gaps:88/300 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 RMLGEGAFGQVHEATAIN-----LRRMRGTTI---------------VAVKQ-------LKPNPK 467
            ::|.:|.|.::.|:.::|     ..|.:||.|               :::||       :..:|.
Zfish    64 QVLDKGRFLRLGESLSLNPGKTLELRCKGTKIGWAYPSYLDTFNDNRLSIKQHERYGQLILTSPS 128

  Fly   468 ADEVAEYLAEIEMLKGVGTHHNVVSFLGCCTIKPPYLMIMEYVNKGNL---------LSYLRTVR 523
            |.:..||...:.:..|.....:|      .||...|:.   :.:|..|         :.|||..:
Zfish   129 AADTGEYSCWVLLCDGQECEKDV------DTISATYIY---FTDKDELFVPSAIHFEIIYLRPDK 184

  Fly   524 KEASKLRNRN-------------------ANYTSCRPIMTRTNSTSSPKSQSVNYIELKASSQTI 569
            ......|..|                   ....|..|.........||:.:...|.:..::|:| 
Zfish   185 PATIPCRVTNPKIKVSLHREVPAEEIAVDGTQISYNPTKGFIIQNPSPEHKGAYYCKANSTSKT- 248

  Fly   570 EMPQEDSTAHMNGIRQPH-PSFA--ETTYTIVEDEDAFEY---ILDNKELH-NFA---------- 617
             .||..:...:..:..|. |.||  |.:...|...|.|..   :|...|:: :|:          
Zfish   249 -TPQISTKYQLLYVEVPSGPPFATIEASSNSVSGGDVFNVTCTVLGEPEMNVSFSWRYPGQDQRP 312

  Fly   618 LQIANGMRFLEEQEITHRDLAARNVLI-DSNKTLKISDFG 656
            :.|.:..|.: .:.:.|....:.:|:| |..:|:   |:|
Zfish   313 VNIQDSWRLI-NRGVGHTTRISHSVMIVDDVETI---DYG 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568 55/299 (18%)
PTKc 430..763 CDD:270623 55/299 (18%)
pdgfrlNP_956608.2 IG_like 178..249 CDD:214653 12/72 (17%)
Ig 186..249 CDD:143165 9/64 (14%)
Ig 287..356 CDD:299845 11/65 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.