DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and Egfr

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster


Alignment Length:527 Identity:125/527 - (23%)
Similarity:211/527 - (40%) Gaps:160/527 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 EKASLSLQAVIIDPTGCEGPRSVTKVPVPANPVLLTEGDSVSNSIIVMSAMLIAIILAGLIMLLL 367
            |...::.|...|.|.....|...:|:         |....|:...|:..|:|:..|....::..:
  Fly   836 EMRHVNYQYTAIGPYCAASPPRSSKI---------TANLDVNMIFIITGAVLVPTICILCVVTYI 891

  Fly   368 RRRRARTTAKLRKQEQIYIQTFATSAIEMEDNVNYVDKYVEKSQVLG--LADIFEVPHSAIQIGR 430
            .|::.:.     |:|.:.: |.|.|..|        |....:...:|  |..:..|..:.::.|.
  Fly   892 CRQKQKA-----KKETVKM-TMALSGCE--------DSEPLRPSNIGANLCKLRIVKDAELRKGG 942

  Fly   431 MLGEGAFGQVHEATAINLRRMRGTTI---VAVKQLKPNPKADEVAEYLAEIEMLKGVGTHHNVVS 492
            :||.||||:|::...:    ..|..:   ||:|:|..:..|:...|:|.|..::..| .|.|::.
  Fly   943 VLGMGAFGRVYKGVWV----PEGENVKIPVAIKELLKSTGAESSEEFLREAYIMASV-EHVNLLK 1002

  Fly   493 FLGCCTIKPPYLMIMEYVNKGNLLSYLRTVRKEASKLRNRNANYTSCRPIMTRTNSTSSPKSQSV 557
            .|..| :....::|.:.:..|.||.|:|..|.:                                
  Fly  1003 LLAVC-MSSQMMLITQLMPLGCLLDYVRNNRDK-------------------------------- 1034

  Fly   558 NYIELKASSQTIEMPQEDSTAHMNGIRQPHPSFAETTYTIVEDEDAFEYILDNKELHNFALQIAN 622
                                                              :.:|.|.|::.|||.
  Fly  1035 --------------------------------------------------IGSKALLNWSTQIAK 1049

  Fly   623 GMRFLEEQEITHRDLAARNVLIDSNKTLKISDFGLSRHGIYTNTRTR------KLPLRWLSIEAI 681
            ||.:|||:.:.||||||||||:.:...:||:||||::  :.::....      |:|::||::|.|
  Fly  1050 GMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAK--LLSSDSNEYKAAGGKMPIKWLALECI 1112

  Fly   682 RENVYSSKSDIWAYGVVLWEIGTLGASPYPTISNDELIPFLMAGNRLERPEICTPQVYTIMLQCW 746
            |..|::||||:||:||.:||:.|.|..|:..|...::...:..|.:||:||||:..:|..:|.||
  Fly  1113 RNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCW 1177

  Fly   747 LEEPEERPTFDALYKV------------------------------------LSPKTTYVDINSL 775
            ..:...||||..|..|                                    |:|.|...:..:.
  Fly  1178 HLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTRLPAYTSQDEKDLIRKLAPTTDGSEAIAE 1242

  Fly   776 SDDYVFP 782
            .|||:.|
  Fly  1243 PDDYLQP 1249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568 95/381 (25%)
PTKc 430..763 CDD:270623 94/377 (25%)
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021
FU 784..834 CDD:214589
PTKc_EGFR_like 930..1208 CDD:270648 96/367 (26%)
STYKc 938..1194 CDD:214568 94/345 (27%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455308
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.