DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and Drl-2

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster


Alignment Length:355 Identity:89/355 - (25%)
Similarity:138/355 - (38%) Gaps:93/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 LADIFEVPHSAIQIGRMLGEGAFGQVHEATAINLRRMRGTTIVAVKQLKPNPKADEVAEYLAEIE 479
            |..|..|...|:....::.||.||:::..      ::..:....||.:.......:||..|.:..
  Fly   370 LRRITSVQPGALSYEELVKEGTFGRIYAG------KLGESCEALVKTVIDGASLTQVACLLQDAS 428

  Fly   480 MLKGVGTHHNVVSFLGCCTIKPPYLMIMEYVNKGNLLSYLRTVRKEASKLRNRNANYTSCRPIMT 544
            :|.||...|.:...|....:..|..:...:.:||||..||:..|                     
  Fly   429 LLIGVSHQHILAPLLANTELPGPPEIAYPHPSKGNLKMYLQKSR--------------------- 472

  Fly   545 RTNSTSSPKSQSVNYIELKASSQTIEMPQEDSTAHMNGIRQPHPSFAETTYTIVEDEDAFEYILD 609
                                         |.|||                             |.
  Fly   473 -----------------------------ESSTA-----------------------------LS 479

  Fly   610 NKELHNFALQIANGMRFLEEQEITHRDLAARNVLIDSNKTLKISDFGLSR------HGIYTNTRT 668
            .::|..|.|.|..|:.:|....|.|:|:|.||..:|....:||.|..|||      :....:...
  Fly   480 TRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNEN 544

  Fly   669 RKLPLRWLSIEAIRENVYSSKSDIWAYGVVLWEIGTLGASPYPTISNDELIPFLMAGNRLERPEI 733
            |  ||:|||:|::::.||:::.|:||.||..||:.||...|:..:...||..:|.||.|||:|..
  Fly   545 R--PLKWLSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQPVN 607

  Fly   734 CTPQVYTIMLQCWLEEPEERPTFDALYKVL 763
            |..:.:|:|..||..|.::|||...|...|
  Fly   608 CPDEFFTVMNCCWHCEAKQRPTPSQLLSYL 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568 84/342 (25%)
PTKc 430..763 CDD:270623 84/338 (25%)
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 88/352 (25%)
STYKc 389..637 CDD:214568 84/334 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.