DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and Pdgfrl

DIOPT Version :10

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001011921.1 Gene:Pdgfrl / 290771 RGDID:1308028 Length:375 Species:Rattus norvegicus


Alignment Length:120 Identity:25/120 - (20%)
Similarity:49/120 - (40%) Gaps:50/120 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RIVLILLLVLVRNAV----GQAPRENATNPTLISLVRSSEKEPEQMESHRYVTGLSEPIAMEPLT 70
            ::.|:|.|:|:..|:    ||.|.:|              |.|::...:|          ::| |
  Rat     2 KVWLLLGLLLLHEALGDVAGQHPPKN--------------KRPKEQGENR----------IKP-T 41

  Fly    71 RMRLNPNPDGEITELTTNVTLYMEKIPRLQVR-WQDNLPQGTSYNVLVSAVNNSR 124
            ..:..|                  |||:::.| ..|:.|:  |.::::.|::|.|
  Rat    42 NKKAKP------------------KIPKIKDRDTADSAPK--SQSIMMQAMDNGR 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 PTKc 430..763 CDD:270623
PdgfrlNP_001011921.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..63 15/86 (17%)
IG_like 83..>143 CDD:214653
Ig 278..372 CDD:472250
Ig strand B 289..293 CDD:409353
Ig strand C 304..308 CDD:409353
Ig strand E 340..344 CDD:409353
Ig strand F 354..359 CDD:409353
Ig strand G 367..370 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.