DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and Pdgfrl

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001011921.1 Gene:Pdgfrl / 290771 RGDID:1308028 Length:375 Species:Rattus norvegicus


Alignment Length:120 Identity:25/120 - (20%)
Similarity:49/120 - (40%) Gaps:50/120 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RIVLILLLVLVRNAV----GQAPRENATNPTLISLVRSSEKEPEQMESHRYVTGLSEPIAMEPLT 70
            ::.|:|.|:|:..|:    ||.|.:|              |.|::...:|          ::| |
  Rat     2 KVWLLLGLLLLHEALGDVAGQHPPKN--------------KRPKEQGENR----------IKP-T 41

  Fly    71 RMRLNPNPDGEITELTTNVTLYMEKIPRLQVR-WQDNLPQGTSYNVLVSAVNNSR 124
            ..:..|                  |||:::.| ..|:.|:  |.::::.|::|.|
  Rat    42 NKKAKP------------------KIPKIKDRDTADSAPK--SQSIMMQAMDNGR 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568
PTKc 430..763 CDD:270623
PdgfrlNP_001011921.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..63 15/86 (17%)
Ig 79..143 CDD:299845
IG_like 83..>143 CDD:214653
I-set 272..373 CDD:254352
Ig 293..372 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.