DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and FLT3

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_004110.2 Gene:FLT3 / 2322 HGNCID:3765 Length:993 Species:Homo sapiens


Alignment Length:503 Identity:154/503 - (30%)
Similarity:239/503 - (47%) Gaps:75/503 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 SELNFRATPKGFEGVMKL----GLGTQLKEKASLSLQAVIIDPTGCEGPRSVTKVPVPANPVLLT 338
            |.||.....|||  ::|.    .|||        |.:.::::..|          |.|...    
Human   499 STLNMSEAIKGF--LVKCCAYNSLGT--------SCETILLNSPG----------PFPFIQ---- 539

  Fly   339 EGDSVSNSIIVMSAMLIAIILAGLIMLLLRRRRARTTAKLRKQEQIYIQTFATSAIEMEDN-VNY 402
              |::|....:...:|..::|..||           ..|.:||.:...|..........|| ..|
Human   540 --DNISFYATIGVCLLFIVVLTLLI-----------CHKYKKQFRYESQLQMVQVTGSSDNEYFY 591

  Fly   403 VD----KYVEKSQVLGLADIFEVPHSAIQIGRMLGEGAFGQVHEATAINLRRMRGTTIVAVKQLK 463
            ||    :|..|         :|.|...::.|::||.||||:|..|||..:.:...:..||||.||
Human   592 VDFREYEYDLK---------WEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLK 647

  Fly   464 PNPKADEVAEYLAEIEMLKGVGTHHNVVSFLGCCTIKPPYLMIMEYVNKGNLLSYLRTVRKEASK 528
            ....:.|....::|::|:..:|:|.|:|:.||.||:..|..:|.||...|:||:|||:.|::..:
Human   648 EKADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHR 712

  Fly   529 LRN---RNANYTSCRPIMTRTNSTSSPKSQSVNYIELKASSQTIEMPQEDSTAHMNGIRQPHPSF 590
            ...   :..|::......:..|| |.|.|:.|   ::...|..|      |..|.|.........
Human   713 TWTEIFKEHNFSFYPTFQSHPNS-SMPGSREV---QIHPDSDQI------SGLHGNSFHSEDEIE 767

  Fly   591 AETTYTIVEDEDAFEYILDNKELHNFALQIANGMRFLEEQEITHRDLAARNVLIDSNKTLKISDF 655
            .|....:.|:||.  .:|..::|..||.|:|.||.|||.:...||||||||||:...|.:||.||
Human   768 YENQKRLEEEEDL--NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDF 830

  Fly   656 GLSR----HGIYTNTRTRKLPLRWLSIEAIRENVYSSKSDIWAYGVVLWEIGTLGASPYPTISND 716
            ||:|    ...|......:||::|::.|::.|.:|:.|||:|:||::||||.:||.:|||.|..|
Human   831 GLARDIMSDSNYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVD 895

  Fly   717 -ELIPFLMAGNRLERPEICTPQVYTIMLQCWLEEPEERPTFDALYKVL 763
             .....:..|.::::|...|.::|.||..||..:..:||:|..|...|
Human   896 ANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFL 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568 120/344 (35%)
PTKc 430..763 CDD:270623 119/340 (35%)
FLT3NP_004110.2 ig 256..345 CDD:278476
PKc_like 572..947 CDD:304357 131/393 (33%)
Important for normal regulation of the kinase activity and for maintaining the kinase in an inactive state in the absence of bound ligand 591..597 3/5 (60%)
Pkinase_Tyr 610..943 CDD:285015 120/344 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.