DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and F40G9.8

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001367839.1 Gene:F40G9.8 / 185556 WormBaseID:WBGene00018244 Length:273 Species:Caenorhabditis elegans


Alignment Length:77 Identity:15/77 - (19%)
Similarity:27/77 - (35%) Gaps:18/77 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 WEIGTLGASPYPTISNDELIPFLMAGNRLERPEICTPQVYTIMLQCWLEEPEERPTFDALYKVLS 764
            ||:..|...|..|..:::...|:.....:...|:||         |.::..:..|.|        
 Worm   157 WEVSWLPDLPVNTRIHEKSKYFISTLRNISSYEVCT---------CVIKTDKFEPMF-------- 204

  Fly   765 PKTTYVDINSLS 776
             ..|.:|:...|
 Worm   205 -LETVIDVKPAS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568 12/62 (19%)
PTKc 430..763 CDD:270623 12/62 (19%)
F40G9.8NP_001367839.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.