DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and B0252.1

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_495419.2 Gene:B0252.1 / 174133 WormBaseID:WBGene00015087 Length:809 Species:Caenorhabditis elegans


Alignment Length:464 Identity:103/464 - (22%)
Similarity:180/464 - (38%) Gaps:124/464 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 IVMSAMLIAIILAGLIM----LLLRRRRARTTAKLRKQEQIYIQTFATSAIEMEDNVNYVDKYVE 408
            |.:..||...|.|.:.:    :|:.|..:|   |.|:|.::      .|.:.::..:....|  |
 Worm   438 IALDDMLTIFICATISVTTFGILIYRHVSR---KHRQQVEL------LSELMLQPRIYKAPK--E 491

  Fly   409 KSQVLGLADIFEVPHSAIQIGR--MLGEGAFGQVHEATAINLRRMRGTT-------IVAVKQLK- 463
            .::|..|.  :|:....:.|.:  :||||....|:      |.:::|.:       .|.:||.: 
 Worm   492 CAKVARLP--WEIKSENVHIDKEFLLGEGTISNVY------LGKLKGKSPIMQWIDRVEMKQYQD 548

  Fly   464 -----------PNPKADEVAEYLAEIEMLKGVGTHHNVVSFLGCCTIKPPYLMIMEYVNKGNLLS 517
                       ..|:.|::...:|.:..|:    ||:.::.|...|.|...:..:..:...||:.
 Worm   549 CAVAVRVPSHFDEPEEDQLQREIASMRQLR----HHDHIALLLGWTNKNDLVCSLLELTHMNLIK 609

  Fly   518 YLRTVRKEASKLRNRNANYTSCRPIMTRTNSTSSPKSQSVNYIELKASSQTIEMPQEDSTAHMNG 582
            ||..:|:.|.                                             |::|:.....
 Worm   610 YLSQIRETAE---------------------------------------------QDNSSGFTPM 629

  Fly   583 IRQPHPSFAETTYTIVEDEDAFEYILDNKELHNFALQIANGMRFLEEQEITHRDLAARNVLIDSN 647
            .|.|.    :..|.|:                   .:|.:|:.::..:.:.||||.|||||:.:.
 Worm   630 SRIPF----QVLYKII-------------------YEICDGIEYIHSRNLVHRDLTARNVLLTTG 671

  Fly   648 KTLKISDFGLSRHG-----IYTNTRTRKLPLRWLSIEAIRENVYSSKSDIWAYGVVLWEIGTLGA 707
            ...|||.||.....     ...:...|.||:|||:.|.. ...:|.|||.|::||:::|:.:||.
 Worm   672 LRAKISGFGFCSEPDDPKFAANSLALRYLPVRWLAPECF-IGKFSVKSDSWSFGVLMYEMFSLGE 735

  Fly   708 SPY-PTISNDELIPFLMAGNRLERPEICTPQVYTIMLQCWLEEPEERPTFDALYKVLSPKTT-YV 770
            .|| ..|..:|:|..:..|.....|:.|:.|.|.||..|:......||.|..|......::| |.
 Worm   736 QPYEDLIRPEEIIESIRKGRVPAHPKYCSKQTYKIMQSCYQSFMSRRPNFTQLKNAFHVQSTNYY 800

  Fly   771 DINSLSDDY 779
            :..:...||
 Worm   801 NNPAFEPDY 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568 82/363 (23%)
PTKc 430..763 CDD:270623 81/359 (23%)
B0252.1NP_495419.2 PKc_like 515..792 CDD:389743 81/355 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.