DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and Fgfrl1

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_473412.1 Gene:Fgfrl1 / 116701 MGIID:2150920 Length:529 Species:Mus musculus


Alignment Length:212 Identity:42/212 - (19%)
Similarity:71/212 - (33%) Gaps:51/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 GKCSCQLAPTPPKVLAVAKMLSNETISINLSILASELLRKEQDSHLHETL---------RTYKMQ 250
            ||.:|:              :||:..:||.:.....:.|......|..|.         .|...|
Mouse   213 GKYTCR--------------VSNKAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQ 263

  Fly   251 LKINEETNPSLPWGGVLKHLMTRVYKLSELNFRAT-PKGFEGVMKLGLGTQLKEKASLSLQAVII 314
            .|:..:..|.:.|       :.||...||....:| ..|.:..:.|..|..........|..::|
Mouse   264 CKVRSDVKPVIQW-------LKRVEYGSEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLI 321

  Fly   315 -----DPTG---CEGPRS---------VTKVPVPANPVLLTEGDSVSNSI---IVMSAMLIAIIL 359
                 |..|   |.|..:         :|.:|.|..|.......|.|.|:   :|:.....|:.:
Mouse   322 SRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPMASSSSSTSLPWPVVIGIPAGAVFI 386

  Fly   360 AGLIMLLLRRRRARTTA 376
            .|.::|.|.:.:.:..|
Mouse   387 LGTVLLWLCQTKKKPCA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568
PTKc 430..763 CDD:270623
Fgfrl1NP_473412.1 I-set 29..112 CDD:369462
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151
Ig2_FGFRL1-like 153..234 CDD:143264 7/34 (21%)
Ig 257..351 CDD:386229 19/100 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.