DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3277 and styk1a

DIOPT Version :9

Sequence 1:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster
Sequence 2:XP_005159545.1 Gene:styk1a / 101886109 ZFINID:ZDB-GENE-060503-428 Length:435 Species:Danio rerio


Alignment Length:467 Identity:91/467 - (19%)
Similarity:169/467 - (36%) Gaps:146/467 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 IIVMSAMLIAIILAGLIMLLL---------------------------------RRRRAR---TT 375
            :||:..:.:.:.||.:|:||:                                 .||..:   ..
Zfish    26 LIVVPVLFLLLFLAIMIILLVLKCSHKKSYRHKHHRKENDHTQHHHNTQGSHRSNRRHLQGIDAP 90

  Fly   376 AKLRKQEQIYIQTFATSAIEMEDNVNYV-----DKYVEKSQVLGLADIFEVPHSAIQIGRMLGEG 435
            |:|...|...|...|.:..|::.:.:.:     :::....|:|          |.:.|...:.:.
Zfish    91 AELNPMEHEVIPMTAQAPHEVQSSASAIPQQTTERHPSSFQLL----------SPLPISFSVKQD 145

  Fly   436 AFGQVHEATAINLRRMRGTTIVAVKQLKPNPKADEVAEYLAEIEMLKGVGTHHNVVSFLGCCTIK 500
            .| .:|.| ||:.:.      |.::.||.:..|.|...:|.....|..:|.|.::...||..:.:
Zfish   146 NF-TLHRA-AIDRQP------VILRVLKESANARERQSFLGFSHFLSELGPHESLPKLLGVVSAR 202

  Fly   501 PPYLMIMEYVNKGNLLSYLRTVRKEASKLRNRNANYTSCRPIMTRTNSTSSPKSQSVNYIELKAS 565
            .|.:|.:|.:...:||.:|                 ..||                         
Zfish   203 TPLMMAVEELEHRDLLGFL-----------------WRCR------------------------- 225

  Fly   566 SQTIEMPQEDSTAHMNGIRQPHPSFAETTYTIVEDEDAFEYILDNKELHNFALQIANGMRFLEEQ 630
                    :|.|.                       .|....:..:.:.....|||:.:.:|..:
Zfish   226 --------QDHTG-----------------------QAAPCDMTERRIFTMGAQIASALEYLHSK 259

  Fly   631 EITHRDLAARNVLIDSNKTLKISDFGLSRHGIYTNT---------RTRKLPLRWLSIEAIRENVY 686
            ...|.::.||:||:..:.::|:...|.:.|. .:|.         .|||    |.:.|.:.....
Zfish   260 NCIHGNVKARSVLVGQDLSVKLWGLGPAYHR-KSNASSIEDLEEIETRK----WQAPELLARQPL 319

  Fly   687 SSKSDIWAYGVVLWEIGTLGASPYPTISNDELIPFLMAGNRLERPEICTPQVYTIMLQCWLEEPE 751
            ...||:|::|::|:|:.|||.:|:|.|...||:..|...|.|:||..|:..:|:||..|.....:
Zfish   320 QQSSDVWSFGILLYEMVTLGEAPFPNIMASELLQHLQRENTLKRPPNCSNTLYSIMKSCCKWRAK 384

  Fly   752 ERPTFDALYKVL 763
            :|.:...|.:.|
Zfish   385 DRVSLAELIRKL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3277NP_608762.3 STYKc 426..763 CDD:214568 72/345 (21%)
PTKc 430..763 CDD:270623 71/341 (21%)
styk1aXP_005159545.1 PKc_like 158..397 CDD:304357 67/323 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.