DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9663 and ABCG27

DIOPT Version :10

Sequence 1:NP_608760.2 Gene:CG9663 / 33541 FlyBaseID:FBgn0031516 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001319729.1 Gene:ABCG27 / 824396 AraportID:AT3G52310 Length:743 Species:Arabidopsis thaliana


Alignment Length:41 Identity:15/41 - (36%)
Similarity:18/41 - (43%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 VIMKKVPLPLVPSSTCERQLQATRLTSRFRLHQTFICAGGE 340
            ||:...|...||.||..::|..|......|..|...||.||
plant   154 VIVPGSPPVSVPGSTAAQKLLRTDKLEVCREFQRGNCARGE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9663NP_608760.2 3a01204 149..808 CDD:273361 15/41 (37%)
ABCG27NP_001319729.1 PLN03211 143..738 CDD:215634 15/41 (37%)

Return to query results.
Submit another query.