DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9663 and AT3G21080

DIOPT Version :10

Sequence 1:NP_608760.2 Gene:CG9663 / 33541 FlyBaseID:FBgn0031516 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_188745.1 Gene:AT3G21080 / 821660 AraportID:AT3G21080 Length:255 Species:Arabidopsis thaliana


Alignment Length:126 Identity:32/126 - (25%)
Similarity:52/126 - (41%) Gaps:37/126 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 LIVFVTALVSQSI-GLAVGAALSLKLGSILGPFFICPFLQFSGFFLMEKDAP-VFLRWMFDISF- 732
            |::.|.:.|...: ||..||.|   :|.|         :..|||..:..|.| :|.|  |.||: 
plant   110 LMMVVASFVPNFLTGLFTGAGL---IGII---------MTSSGFSRLLPDLPKIFCR--FSISYT 160

  Fly   733 LKYSLEGATMAIFGYDRE---PLACNELYCHLRHPQFILKSLDMANGNYTLALIFLFGVLV 790
            :.|.:.|:.....|::..   ||:.:|       |:...:.::|..          |||.|
plant   161 ISYMIFGSWAIKLGHNNNFLGPLSPDE-------PKMTGEEMNMNE----------FGVKV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9663NP_608760.2 3a01204 149..808 CDD:273361 32/126 (25%)
AT3G21080NP_188745.1 None

Return to query results.
Submit another query.