DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9663 and Abca7

DIOPT Version :9

Sequence 1:NP_608760.2 Gene:CG9663 / 33541 FlyBaseID:FBgn0031516 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001334010.1 Gene:Abca7 / 27403 MGIID:1351646 Length:2167 Species:Mus musculus


Alignment Length:306 Identity:91/306 - (29%)
Similarity:142/306 - (46%) Gaps:43/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LMGLTGYFKSGELSAVIGPSGAGKSTLLNILSGYTTYGFTGDFRVNGN--RRDLKAFKSNVAFIR 232
            |.||...|..|.::|.:|.:||||:|.|:||||..... :|...:.|:  :.::.|.:.::....
Mouse   821 LQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPS-SGSASILGHDVQTNMAAIRPHLGICP 884

  Fly   233 QDTSLQAFLSVKEAMHFAANLKIGTHMTHSEKRERVKCILEAIGMYENRHTRTGQLSGGQKKRLA 297
            |...|...|:|:|.:.|...||..:......:|||   ::..:|:...|.|:|..||||.:::|:
Mouse   885 QYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERER---LIRDVGLTLKRDTQTRHLSGGMQRKLS 946

  Fly   298 IALELVNNPPVLILDEPTTGLDSFTSNQLINLLKKLAIEGRTVICTIHQPSALTFAMFDHLYAIG 362
            :|:..|....|:|:||||.|:|..:...:..||.|.. ||||:|.:.|.        .|....:|
Mouse   947 VAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYR-EGRTLILSTHH--------LDEAELLG 1002

  Fly   363 EGKCIYAGGAQNLLPFLGA---LNLHCPESYNPADYL------MEIATHD-YDTAEDNQLEKLVA 417
            :...:.|||:   |...|:   |..|....|    ||      ..:.||| ...:||.:.||  .
Mouse  1003 DRVAMVAGGS---LCCCGSPLFLRRHLGCGY----YLTLVKSSQSLVTHDAKGDSEDPRREK--K 1058

  Fly   418 LMDNGRNEDYRQSKTARVAQLAAMKKVDQLMAAGL--ITPVTAPVM 461
            ...|||..|...::       ....|.:|..|.|.  |||.||.::
Mouse  1059 SDGNGRTSDTAFTR-------GTSDKSNQAPAPGAVPITPSTARIL 1097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9663NP_608760.2 ABCG_EPDR 145..370 CDD:213180 61/201 (30%)
3a01204 149..808 CDD:273361 91/306 (30%)
ABC2_membrane 540..743 CDD:279410
Abca7NP_001334010.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1042..1088 15/54 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1172..1192
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2126..2167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.