DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9663 and Abca2

DIOPT Version :9

Sequence 1:NP_608760.2 Gene:CG9663 / 33541 FlyBaseID:FBgn0031516 Length:808 Species:Drosophila melanogaster
Sequence 2:XP_006497672.1 Gene:Abca2 / 11305 MGIID:99606 Length:2464 Species:Mus musculus


Alignment Length:279 Identity:71/279 - (25%)
Similarity:125/279 - (44%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PLGATPVSSPANQSQR-SQASQHSDESRNTSSTATSGGSIFPHEQYKTIKKINIGFENIRYTTKF 159
            |...||..|...:.|. :..|:|.:|:|..             |:..|...:.:..:.:   || 
Mouse   980 PWAHTPRLSVMEEDQACAMESRHFEETRGM-------------EEEPTHLPLVVCVDKL---TK- 1027

  Fly   160 GVFQRETKDVLMGLTGYFKSGELSAVIGPSGAGKSTLLNILSGY--------TTYGFTGDFRVNG 216
             |::.:.|..|..|:......::.:.:|.:||||:|.::||:|.        |.||       :.
Mouse  1028 -VYKNDKKMALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYG-------HD 1084

  Fly   217 NRRDLKAFKSNVAFIRQDTSLQAFLSVKEAMHFAANLKIGTHMTHSEKRERVKCILEAIGMYENR 281
            .|.::...:.|:....|...|...|:|:|.:.|.:.||   .|...|.|:....::|.:.:...|
Mouse  1085 IRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLK---SMAQEEIRKETDKMIEDLELSNKR 1146

  Fly   282 HTRTGQLSGGQKKRLAIALELVNNPPVLILDEPTTGLDSFTSNQLINLLKKLAIEGRTVICTIHQ 346
            |:....||||.|::|::|:..|.....:||||||.|:|.:....:.:|:.|.. .|||::.:.|.
Mouse  1147 HSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYK-PGRTILLSTHH 1210

  Fly   347 PSALTFAMFDHLYAIGEGK 365
            ...... :.|.:..|..||
Mouse  1211 MDEADL-LGDRIAIISHGK 1228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9663NP_608760.2 ABCG_EPDR 145..370 CDD:213180 60/229 (26%)
3a01204 149..808 CDD:273361 60/225 (27%)
ABC2_membrane 540..743 CDD:279410
Abca2XP_006497672.1 rim_protein 58..2398 CDD:130324 71/279 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.