DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9664 and ABCG29

DIOPT Version :9

Sequence 1:NP_722889.1 Gene:CG9664 / 33540 FlyBaseID:FBgn0031515 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_566543.1 Gene:ABCG29 / 820881 AraportID:AT3G16340 Length:1416 Species:Arabidopsis thaliana


Alignment Length:572 Identity:166/572 - (29%)
Similarity:276/572 - (48%) Gaps:77/572 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LELHFSQVSYSL--------KGATKGSTPIINEACGVFKSGRLTAILGPSGAGKSTLLNALAGFK 77
            |.:.|..|:|.:        :|.:|....::.|..|||:.|.|||::|.|||||:||::.|||.|
plant   812 LTMSFDNVNYYVDMPKEMKEQGVSKDKLQLLKEVTGVFRPGVLTALMGVSGAGKTTLMDVLAGRK 876

  Fly    78 LQG-VTGQFLLNGRPRDIMSFRKMSAYIAQNFVMLNLLTVEETLRVSTDLKMPSSTAAQEKQKII 141
            ..| :.|...::|.|:...:|.::|.|..||.:....:||:|:|..|..|::|......||.:.:
plant   877 TGGYIEGDIRISGFPKRQETFARISGYCEQNDIHSPQVTVKESLIYSAFLRLPKEVTKYEKMRFV 941

  Fly   142 DDIIDILQLQSCRRTLV-----KNLSGGEHKRLSIGIELVTNPPIMFFDEPTSGLDCVGSYQVIC 201
            |:::::::|:|.:..:|     ..||..:.|||:|.:|||.||.|:|.||||||||...:..|:.
plant   942 DEVMELVELESLKDAVVGLPGITGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMR 1006

  Fly   202 HLQRLAHDGRIVVCVVHQPGSRLFQLFDDVLVLAH-GEVLYA---GEQREMLPTFAQSGHICP-- 260
            .::.....||.|||.:|||...:|:.||::|:|.. |:|:||   |:....:..:.|:.|..|  
plant  1007 TVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLLKRGGQVIYAGPLGQNSHKIIEYFQAIHGVPKI 1071

  Fly   261 -QYYNPADFALEVCSQSSTTE---------RCESLITQNKMMHSTASNVVKLQVDEETALIDVHK 315
             :.||||.:.|||.|.::..:         :..||..|||       |:||..........|::.
plant  1072 KEKYNPATWMLEVSSMAAEAKLEIDFAEHYKTSSLYQQNK-------NLVKELSTPPQGASDLYF 1129

  Fly   316 DALDLSHLRGKEQVGFWTQLSVLLRRHLRSMSRDMFAVQMRLVMHVVVALLLGVVYWQIG---GD 377
            .......|.|:.:...|.|.....|....:::|..|.        :..|::||.::|::|   .:
plant  1130 STRFSQSLLGQFKSCLWKQWITYWRTPDYNLARFFFT--------LAAAVMLGSIFWKVGTKREN 1186

  Fly   378 AQKIVSNVSCLFFVILFVFAGNAMPSILLCMQDSAVFIREYYNGWYSLGAYYLSKVLADLPLQLT 442
            |..:...:..::..:|||...|:.....|...:.:||.||.....||...|.|::|:.::|..|.
plant  1187 ANDLTKVIGAMYAAVLFVGVNNSSSVQPLIAVERSVFYRERAAEMYSALPYALAQVVCEIPYVLI 1251

  Fly   443 CPTMFISIGYFMTGQPPEFQRFAMCWALCVMTAFIGHFIGVIAGSLFTM--QLAIFLVPSATIP- 504
            ..|.:..|.|.|           ||:...:...|..:|:..::...||.  .:.:.|.|:..:. 
plant  1252 QTTYYTLIIYAM-----------MCFEWTLAKFFWFYFVSFMSFLYFTYYGMMTVALTPNQQVAA 1305

  Fly   505 ---------FLLFSGFFI-RLNELSWFL--RPICDVSFFRYIFEGLMRAIYG 544
                     |.|||||.| |.....|::  ..||.|::..|   ||:.:.||
plant  1306 VFAGAFYGLFNLFSGFVIPRPRIPKWWIWYYWICPVAWTVY---GLIVSQYG 1354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9664NP_722889.1 ABCG_EPDR 20..243 CDD:213180 87/239 (36%)
EcfA2 23..247 CDD:224047 87/241 (36%)
ABC2_membrane 338..539 CDD:279410 51/218 (23%)
YadH <388..547 CDD:223912 45/172 (26%)
ABCG29NP_566543.1 PLN03140 1..1416 CDD:215599 166/572 (29%)
ABC_trans_N 54..141 CDD:291196
ABCG_PDR_domain1 156..402 CDD:213200
ABC2_membrane 503..709 CDD:279410
PDR_assoc 716..780 CDD:285559
ABCG_PDR_domain2 811..1049 CDD:213199 86/236 (36%)
ABC2_membrane 1144..1351 CDD:279410 54/228 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X52
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.