DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9664 and Abca4

DIOPT Version :9

Sequence 1:NP_722889.1 Gene:CG9664 / 33540 FlyBaseID:FBgn0031515 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_001101191.1 Gene:Abca4 / 310836 RGDID:1309445 Length:2290 Species:Rattus norvegicus


Alignment Length:314 Identity:75/314 - (23%)
Similarity:127/314 - (40%) Gaps:46/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GSTPIINEACGVFKSGRLTAILGPSGAGKSTLLNALAGFKLQGVTGQFLLNGRPRDIM--SFRKM 100
            ||.|.::.....|...::||.||.:||||:|.|:.|.|. |...:|..|:.|:..:|.  :.|:.
  Rat   919 GSRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGL-LPPTSGTVLIGGKDIEISLDAVRQS 982

  Fly   101 SAYIAQNFVMLNLLTVEETLRVSTDLKMPS-STAAQEKQKIIDDIIDILQLQSCRRTLVKNLSGG 164
            .....|:.::.:.|||.|.:.....||..| ..|..|.:.:::|    ..|...|....::||||
  Rat   983 LGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEARLEMEAMLED----TGLHHKRNEEAQDLSGG 1043

  Fly   165 EHKRLSIGIELVTNPPIMFFDEPTSGLDCVGSYQVICHLQRLAHDGRIVVCVVHQPGSRLFQLFD 229
            ..::||:.|..|.:..::..||||||:|.. |.:.|..|......||.::...|.. .....|.|
  Rat  1044 MQRKLSVAIAFVGDSKVVVLDEPTSGVDPY-SRRSIWDLLLKYRSGRTIIMSTHHM-DEADLLGD 1106

  Fly   230 DVLVLAHGEVLYAGEQREMLPTFAQSGHI-------------------CPQYYNPADFALEVCSQ 275
            .:.:::.|.:..:|....:...|....::                   |.            |:.
  Rat  1107 RIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRCGCEGACS------------CTS 1159

  Fly   276 SSTTERCESLITQNKMMHSTASNVVKLQVDEETALIDVHKDALDLSHLRGKEQV 329
            ...:.||.:.:.:     .|...|:...|.|.|.|:..|.....|....|:|.:
  Rat  1160 KGFSARCPARVDE-----ITEEQVLDGDVKELTDLVYHHVPEAKLVECIGQELI 1208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9664NP_722889.1 ABCG_EPDR 20..243 CDD:213180 59/207 (29%)
EcfA2 23..247 CDD:224047 60/211 (28%)
ABC2_membrane 338..539 CDD:279410
YadH <388..547 CDD:223912
Abca4NP_001101191.1 rim_protein 1..2249 CDD:130324 75/314 (24%)
ABC_subfamily_A 907..1126 CDD:213230 60/213 (28%)
ABC_subfamily_A 1915..2135 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.