DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9664 and Abca2

DIOPT Version :9

Sequence 1:NP_722889.1 Gene:CG9664 / 33540 FlyBaseID:FBgn0031515 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_006497672.1 Gene:Abca2 / 11305 MGIID:99606 Length:2464 Species:Mus musculus


Alignment Length:305 Identity:80/305 - (26%)
Similarity:129/305 - (42%) Gaps:53/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RLTAILGPSGAGKSTLLNALAGFKLQGVTGQFLLNGRPRDIMS----FRKMSAYIAQNFVMLNLL 114
            ::.:.||.:||||:|.::.|.|. ....:|...:.|  .||.:    .||......|:.|:.:.|
Mouse  1048 QVVSFLGHNGAGKTTTMSILTGL-FPPTSGSATIYG--HDIRTEMDEIRKNLGMCPQHNVLFDRL 1109

  Fly   115 TVEETLRVSTDLKMPSSTAAQEKQKIIDDIIDILQLQSCRRTLVKNLSGGEHKRLSIGIELVTNP 179
            ||||.|...:.||   |.|.:|.:|..|.:|:.|:|.:.|.:||:.||||..::||:.|..|...
Mouse  1110 TVEEHLWFYSRLK---SMAQEEIRKETDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGS 1171

  Fly   180 PIMFFDEPTSGLDCVGSYQVICHLQRLAHDGRIVVCVVHQPGSRLFQLFDDVLVLAHGEV----- 239
            ..:..||||:|:|.. :.:.|..|......||.::...|.. .....|.|.:.:::||::     
Mouse  1172 RAIILDEPTAGVDPY-ARRAIWDLILKYKPGRTILLSTHHM-DEADLLGDRIAIISHGKLKCCGS 1234

  Fly   240 ------LYAGEQREML------------PTFAQSGHICPQYYNPADFALEVCSQSSTTERCESLI 286
                  .|....|..|            |..|.|...||:        |..||:...::.....:
Mouse  1235 PLFLKGAYGDGYRLTLVKQPAEPGTSQEPGLASSPSGCPR--------LSSCSEPQVSQFIRKHV 1291

  Fly   287 TQNKMMHSTA--------SNVVKLQVDEETALIDVHKDALDLSHL 323
            ..:.::..|:        |..||....|.  |....:.:||..||
Mouse  1292 ASSLLVSDTSTELSYILPSEAVKKGAFER--LFQQLEHSLDALHL 1334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9664NP_722889.1 ABCG_EPDR 20..243 CDD:213180 60/203 (30%)
EcfA2 23..247 CDD:224047 60/207 (29%)
ABC2_membrane 338..539 CDD:279410
YadH <388..547 CDD:223912
Abca2XP_006497672.1 rim_protein 58..2398 CDD:130324 80/305 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.