DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3347 and AL7

DIOPT Version :10

Sequence 1:NP_722887.2 Gene:CG3347 / 33538 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_172903.1 Gene:AL7 / 838013 AraportID:AT1G14510 Length:252 Species:Arabidopsis thaliana


Alignment Length:68 Identity:22/68 - (32%)
Similarity:30/68 - (44%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PVQKINVFGEADTAVSSKDVYCICRQSHING--FMICCDNCNEWFHGDCIGLPANIGEQHDTYYC 65
            |.:|.:..|:.|.......|...|..:: .|  |.||||.|.:||||.|:.:.....|....|.|
plant   178 PPRKEDESGDEDEDDEQGAVCGACGDNY-GGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKC 241

  Fly    66 TEC 68
            ..|
plant   242 PSC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3347NP_722887.2 PHD_SF 23..68 CDD:473978 16/46 (35%)
AL7NP_172903.1 Alfin 12..139 CDD:463480
PHD_AL_plant 198..246 CDD:277085 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.