DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3347 and AL5

DIOPT Version :10

Sequence 1:NP_722887.2 Gene:CG3347 / 33538 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_197551.2 Gene:AL5 / 832173 AraportID:AT5G20510 Length:260 Species:Arabidopsis thaliana


Alignment Length:38 Identity:16/38 - (42%)
Similarity:20/38 - (52%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRK 71
            |.||||.|.:||||:|:.:.....|....|.|..|..|
plant   219 FWICCDMCEKWFHGECVKITPARAEHIKHYKCPTCSNK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3347NP_722887.2 PHD_SF 23..68 CDD:473978 14/33 (42%)
AL5NP_197551.2 Alfin 13..140 CDD:463480
PHD_AL_plant 206..256 CDD:277085 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.