DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3347 and EBS

DIOPT Version :10

Sequence 1:NP_722887.2 Gene:CG3347 / 33538 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_193945.2 Gene:EBS / 828303 AraportID:AT4G22140 Length:234 Species:Arabidopsis thaliana


Alignment Length:85 Identity:22/85 - (25%)
Similarity:38/85 - (44%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EADTAVSSKD---VYCICRQSH-INGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKN 72
            :|.|...:.|   |||.|...: .:..|:.|:.|.:|:|..|:|:.....::.|.:.|.||...:
plant   134 KAATGAFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCAECSSDD 198

  Fly    73 PLLKCTYKKSPSTTGVPKTP 92
            .:.|       |..|...:|
plant   199 DVKK-------SQNGFTSSP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3347NP_722887.2 PHD_SF 23..68 CDD:473978 12/45 (27%)
EBSNP_193945.2 BAH_BAHCC1 30..164 CDD:240065 8/29 (28%)
PHD_SF 148..194 CDD:473978 12/45 (27%)

Return to query results.
Submit another query.