DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3347 and AL6

DIOPT Version :10

Sequence 1:NP_722887.2 Gene:CG3347 / 33538 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_178351.1 Gene:AL6 / 814776 AraportID:AT2G02470 Length:256 Species:Arabidopsis thaliana


Alignment Length:38 Identity:16/38 - (42%)
Similarity:19/38 - (50%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRK 71
            |.||||.|.:||||.|:.:.....|....|.|..|..|
plant   215 FWICCDACEKWFHGKCVKITPAKAEHIKHYKCPTCSNK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3347NP_722887.2 PHD_SF 23..68 CDD:473978 14/33 (42%)
AL6NP_178351.1 Alfin 12..139 CDD:463480
PHD_AL_plant 203..252 CDD:277085 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.