DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3347 and nurf-1

DIOPT Version :10

Sequence 1:NP_722887.2 Gene:CG3347 / 33538 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001364539.1 Gene:nurf-1 / 175098 WormBaseID:WBGene00009180 Length:2199 Species:Caenorhabditis elegans


Alignment Length:51 Identity:18/51 - (35%)
Similarity:29/51 - (56%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VYCICRQSHIN-GFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRK 71
            :||:|::.:.: .|.:.||:|..|||.:|:|......||...|.|..|.|:
 Worm  1965 LYCVCQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACTRE 2015

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3347NP_722887.2 PHD_SF 23..68 CDD:473978 16/45 (36%)
nurf-1NP_001364539.1 DDT 196..256 CDD:214726
PHD 350..389 CDD:214584
WSD 410..>459 CDD:464775
PHD_SF 1906..1952 CDD:473978
PHD2_3_BPTF 1966..2012 CDD:277035 16/45 (36%)
Bromo_gcn5_like 2054..2139 CDD:99941
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.